2OQ1: Tyrosine-protein kinase ZAP-70

Tandem SH2 domains of ZAP-70 with 19-mer zeta1 peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 Mar 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,312
Mol. weight: 31.63 kDa
Ligands: PB
Released: 6 Mar 2007

Explore 2OQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OQ1 contains 14 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	15	1	2
α-helix	19-28	10
β-strand	36-40	5	1
β-strand	48-54	7	1
β-strand	57-65	9	1
α-helix	66	1
β-strand	71-73	3	1
β-strand	79	1	1
α-helix	82-91	10
β-strand	103	1	1
α-helix	105-107	3
α-helix	112	1
β-strand	113	1	2
α-helix	114-115	2
α-helix	116-133	18
α-helix	137-158	22
α-helix	159-162	4
β-strand	166	1	3
α-helix	172-180	9
β-strand	188-193	6	3
β-strand	199-206	8	3
β-strand	209-217	9	3
β-strand	223-224	2	3
β-strand	231	1	3
α-helix	234-243	10
β-strand	255	1	3

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	304-307	4
α-helix	309-311	3
α-helix	312-314	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase ZAP-70	A	protein	254	Homo sapiens	P43403 (AlphaFold model)
T-cell surface glycoprotein CD3 zeta chain	B	protein	19		P20963 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OQ1_1 Tyrosine-protein kinase ZAP-70 (chains A)
DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIE
RQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAM
VRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQ
TDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLK
ADGLIYCLKEACPN

Sequence of entity 2 (B), FASTA

>2OQ1_2 T-cell surface glycoprotein CD3 zeta chain (chains B)
NQLYNELNLGRREEYDVLD

Ligands and cofactors

ID	Name	Formula	Copies
PB	Lead (II) ion	Pb	1

Primary citation

Molecular basis for the interaction of ZAP-70 with the T-cell receptor. Hatada, M.H., Lu, X., Laird, E.R. et al. Nature (1995) 377:32-38. DOI 10.1038/377032a0 · PubMed

Other PDB entries of the same protein (UniProt P43403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SIY 1.48 Å, cCBL TKB domain in complex with pZAP70 peptide
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
4XZ0 2.0 Å, ZAP-70-tSH2:compound-A complex
2CBL 2.1 Å, N-terminal domain of cbl in complex with its binding site on zap-70
3ZNI 2.21 Å, Structure of phosphoTyr363-Cbl-b - UbcH5B-Ub - ZAP-70 peptide complex
1U59 2.3 Å, Crystal Structure of the ZAP-70 Kinase Domain in Complex with Staurosporine
5O76 2.47 Å, Structure of phosphoY371 c-CBL in complex with ZAP70-peptide and UbV.pCBL ubiquitin…
1M61 2.5 Å, Crystal structure of the apo SH2 domains of ZAP-70
2OZO 2.6 Å, Autoinhibited intact human ZAP-70
4A4C 2.7 Å, Structure of phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4A4B 2.79 Å, Structure of modified phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
4XZ1 2.8 Å, ZAP-70-tSH2:Compound-B adduct

Browse structure collections

About this viewer

MolViewer shows 2OQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.