2P28: Integrin beta-2

Structure of the PHE2 and PHE3 fragments of the integrin beta2 subunit. Determined by X-ray diffraction at 2.2 Å resolution. Released 14 Aug 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,569
Mol. weight: 35.14 kDa
Ligands: NAG
Released: 14 Aug 2007

Explore 2P28 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P28 contains 9 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	11-17	7
β-strand	22-24	3	1
α-helix	27-29	3
α-helix	36-39	4
β-strand	40-41	2	1
α-helix	43-47	5
α-helix	53-55	3
β-strand	56-57	2	1
β-strand	62-67	6	2
β-strand	76-77	2	3
β-strand	80-85	6	2
β-strand	91-97	7	3

Chain B: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	342	1	4
β-strand	345-349	5	2
β-strand	356-363	8	3
β-strand	369-373	5	3
β-strand	376-378	3	2
β-strand	381	1	4
β-strand	387-395	9	3
β-strand	402-408	7	2
β-strand	414-421	8	2
β-strand	441-444	4	5
β-strand	447-450	4	5
β-strand	454-455	2	6
β-strand	461-462	2	6
α-helix	469-475	7
β-strand	476	1	7
β-strand	483	1	7
α-helix	484-486	3
β-strand	488-491	4	8
β-strand	494-497	4	8
α-helix	498-499	2
β-strand	507-508	2	9
β-strand	514-515	2	9
β-strand	521-522	2	10
β-strand	525-526	2	10
β-strand	533-536	4	11
β-strand	539-542	4	11
α-helix	543	1
β-strand	546-547	2	12
β-strand	553-554	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-2	A	protein	100	Homo sapiens	P05107 (AlphaFold model)
Integrin beta-2	B	protein	217	Homo sapiens	P05107 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P28_1 Integrin beta-2 (chains A)
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPT
SLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRA

Sequence of entity 2 (B), FASTA

>2P28_2 Integrin beta-2 (chains B)
KLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECI
QEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
ECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINC
ERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

A structural hypothesis for the transition between bent and extended conformations of the leukocyte beta2 integrins. Shi, M., Foo, S.Y., Tan, S.M. et al. J Biol Chem (2007) 282:30198-30206. DOI 10.1074/jbc.M701670200 · PubMed

Other PDB entries of the same protein (UniProt P05107 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2P26 1.75 Å, Structure of the PHE2 and PHE3 fragments of the integrin beta2 subunit
5E6X 1.75 Å, Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid…
1YUK 1.8 Å, The crystal structure of the PSI/Hybrid domain/ I-EGF1 segment from the human integrin…
5E6V 1.8 Å, Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid…
5E6S 2.15 Å, Structures of leukocyte integrin aLB2: The aI domain, the headpiece, and the pocket for…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
5E6W 2.2 Å, Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid…
2V7D 2.5 Å, 14-3-3 protein zeta in complex with Thr758 phosphorylated integrin beta2 peptide
5E6U 2.5 Å, Structures of leukocyte integrin aLb2: The aI domain, the headpiece, and the pocket for…
9RM9 2.6 Å, Cryo-EM structure of alphaM/beta2 headpiece complex without alphaM I-domain - the…
7USL 2.7 Å, Integrin alphaM/beta2 ectodomain in complex with adenylate cyclase toxin RTX751 and M1F5…
7USM 2.7 Å, Integrin alphaM/beta2 ectodomain

Browse structure collections

About this viewer

MolViewer shows 2P28 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.