2P40: Dengue Methyltransferase

Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Aug 2007.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Dengue virus 2
Chains: 1
Atoms: 2,226
Mol. weight: 36.26 kDa
Ligands: GTG
Released: 28 Aug 2007

Explore 2P40 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P40 contains 12 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	22-30	9
β-strand	34-36	3	1
α-helix	39-46	8
α-helix	58-67	10
β-strand	75-80	6	2
α-helix	86-92	7
β-strand	97-103	7	2
α-helix	121-123	3
β-strand	124-127	4	2
α-helix	132-134	3
β-strand	142-145	4	2
α-helix	154-171	18
β-strand	177-182	6	2
α-helix	188-201	14
β-strand	204-206	3	2
β-strand	218-221	4	2
α-helix	228-242	15
α-helix	249-250	2
β-strand	251-253	3	1
α-helix	254-256	3
β-strand	260	1	3
β-strand	267	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
type II methyltransferase	A	protein	305	Dengue virus 2	P12823

Sequence of entity 1 (A), FASTA

>2P40_1 type II methyltransferase (chains A)
MRGSHHHHHHGSNIGETLGEKWKSRLNALGKSEFQIYKKSGIQEVDRTLAKEGIKRGETD
HHAVSRGSAKLRWFVERNLVTPEGKVVDLGCGRGGWSYYCGGLKNVREVKGLTKGGPGHE
EPIPMSTYGWNLVRLQSGVDVFFIPPERCDTLLCDIGESSPNPTVEAGRTLRVLNLVENW
LSNNTQFCVKVLNPYMSSVIEKMEALQRKHGGALVRNPLSRNSTHEMYWVSNASGNIVSS
VNMISRMLINRFTMRHKKATYEPDVDLGSGTRNIGIESETPNLDIIGKRIEKIKQEHETS
WHYDQ

Ligands and cofactors

ID	Name	Formula	Copies
GTG	7-methyl-guanosine-5'-triphosphate-5'-guanosine	C21 H30 N10 O18 P3	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural and functional analysis of methylation and 5'-RNA sequence requirements of short capped RNAs by the methyltransferase domain of dengue virus NS5. Egloff, M.P., Decroly, E., Malet, H. et al. J Mol Biol (2007) 372:723-736. DOI 10.1016/j.jmb.2007.07.005 · PubMed

Other PDB entries of the same protein (UniProt P12823), best resolution first:

4M9K 1.46 Å, NS2B-NS3 protease from dengue virus at pH 5.5
4M9M 1.53 Å, NS2B-NS3 protease from dengue virus at pH 8.5
4M9T 1.74 Å, NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric…
2P41 1.8 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and…
1OK8 2.0 Å, Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion…
2P3L 2.2 Å, Crystal Structure of Dengue Methyltransferase in Complex with GpppA and…
5HHG 2.2 Å, Mouse importin alpha: Dengue 2 NS5 C-terminal NLS peptide complex
1L9K 2.4 Å, dengue methyltransferase
1OKE 2.4 Å, Crystal structure of the dengue 2 virus envelope protein in complex with…
4M9I 2.4 Å, A125C NS2B-NS3 protease from dengue virus at pH 5.5
1R6A 2.6 Å, Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl…
4M9F 2.7 Å, Dengue virus NS2B-NS3 protease A125C variant at pH 8.5

Browse structure collections

About this viewer

MolViewer shows 2P40 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.