2Q98: Prolactin antagonist

X-ray structure of a prolactin antagonist. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Sept 2007.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,615
Mol. weight: 22.36 kDa
Released: 11 Sept 2007

Explore 2Q98 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q98 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	15-45	31
α-helix	59-62	4
α-helix	70-74	5
α-helix	77-90	14
α-helix	92-103	12
α-helix	110-137	28
α-helix	153-156	4
α-helix	161-193	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin	A	protein	191	Homo sapiens	P01236 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Q98_1 Prolactin (chains A)
MRSQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPED
KEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLE
RMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKL
LKCRIIHNNNC

Primary citation

Structural and thermodynamic bases for the design of pure prolactin receptor antagonists: X-ray structure of Del1-9-G129R-hPRL. Jomain, J.B., Tallet, E., Broutin, I. et al. J Biol Chem (2007) 282:33118-33131. DOI 10.1074/jbc.M704364200 · PubMed

Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
3NPZ 3.35 Å, Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL)
3EW3 3.8 Å, the 1:2 complex between a Nterminal elongated prolactin and the extra cellular domain of…
1RW5 Solution structure of human prolactin

Browse structure collections

About this viewer

MolViewer shows 2Q98 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.