3NPZ: Prolactin Receptor

Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL). Determined by X-ray diffraction at 3.35 Å resolution. Released 6 Oct 2010.

Method: X-ray diffraction
Resolution: 3.35 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 3
Atoms: 4,817
Mol. weight: 74.73 kDa
Released: 6 Oct 2010

Explore 3NPZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NPZ contains 17 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	15-44	30
α-helix	69-72	4
α-helix	77-103	27
α-helix	114-136	23
α-helix	164-189	26
α-helix	190-194	5

Chain B: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-13	6	1
β-strand	14	1	2
β-strand	20-25	6	1
β-strand	35-41	7	3
β-strand	48-50	3	3
β-strand	61-64	4	1
β-strand	74-82	9	3
β-strand	87-89	3	3
α-helix	90-92	3
β-strand	93-96	4	3
α-helix	97-99	3
β-strand	101	1	2
α-helix	103-106	4
β-strand	107-115	9	4
β-strand	121-128	8	4
β-strand	142-150	9	5
β-strand	157-162	6	5
β-strand	166-169	4	4
α-helix	172-173	2
β-strand	177-186	10	5
α-helix	193-195	3
β-strand	198-201	4	5

Chain C: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	6
β-strand	14	1	7
β-strand	20-24	5	6
β-strand	35-40	6	8
β-strand	42	1	9
β-strand	49-50	2	8
β-strand	61-64	4	6
β-strand	75-77	3	9
β-strand	78-83	6	8
β-strand	86-87	2	8
α-helix	90-92	3
β-strand	93-95	3	9
α-helix	97-99	3
β-strand	101	1	7
α-helix	103-106	4
β-strand	107-114	8	10
β-strand	122-128	7	10
β-strand	143-149	7	11
β-strand	157-161	5	11
β-strand	166-169	4	10
β-strand	177-185	9	11
α-helix	189-196	8
β-strand	198-201	4	11
α-helix	202-203	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin	A	protein	199	Homo sapiens	P01236 (AlphaFold model)
Prolactin receptor	B, C	protein	220	Rattus norvegicus	P05710 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NPZ_1 Prolactin (chains A)
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHT
SSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIE
EQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSH
KIDNYLKLLKCRIIHNNNC

Sequence of entity 2 (B, C), FASTA

>3NPZ_2 Prolactin receptor (chains B, C)
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPN
SCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKK
TYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLV
QTRCKPDHGYWSRWSQESSVEMPNDFTLKDRSRSHHHHHH

Primary citation

Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone. van Agthoven, J., Zhang, C., Tallet, E. et al. J Mol Biol (2010) 404:112-126. DOI 10.1016/j.jmb.2010.09.036 · PubMed

Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
2Q98 2.7 Å, X-ray structure of a prolactin antagonist
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
3EW3 3.8 Å, the 1:2 complex between a Nterminal elongated prolactin and the extra cellular domain of…
1RW5 Solution structure of human prolactin

Browse structure collections

About this viewer

MolViewer shows 3NPZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.