2QDF: N-terminal domain of E. Coli YaeT

Structure of N-terminal domain of E. Coli YaeT. Determined by X-ray diffraction at 2.2 Å resolution. Released 4 Sept 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli K12
Chains: 1
Atoms: 2,612
Mol. weight: 37.48 kDa
Ligands: MG
Released: 4 Sept 2007

Explore 2QDF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QDF contains 13 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	1
β-strand	28-32	5	2
α-helix	39-44	6
β-strand	53-54	2	1
α-helix	56-67	12
β-strand	72-80	9	2
β-strand	83-90	8	2
α-helix	91-92	2
β-strand	93-100	8	3
α-helix	107-115	9
β-strand	124	1	3
α-helix	125	1
α-helix	130-140	11
α-helix	141-144	4
β-strand	146	1	4
β-strand	150-158	9	3
β-strand	162-170	9	3
β-strand	174	1	4
β-strand	176-183	8	5
α-helix	190-194	5
α-helix	195-197	3
α-helix	219-231	13
β-strand	239-247	9	5
β-strand	253-261	9	5
β-strand	267-276	10	6
α-helix	281-287	7
β-strand	294-295	2	6
α-helix	296	1
α-helix	298-313	16
β-strand	317	1	7
β-strand	321-329	9	6
β-strand	334-342	9	6
β-strand	346	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor yaeT	A	protein	335	Escherichia coli K12	P0A940 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QDF_1 Outer membrane protein assembly factor yaeT (chains A)
GSHMAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVR
VLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKG
LEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISH
FQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYV
TVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYG
YAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structure and function of an essential component of the outer membrane protein assembly machine. Kim, S., Malinverni, J.C., Sliz, P. et al. Science (2007) 317:961-964. DOI 10.1126/science.1143993 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A
6QGY 2.51 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody B12

Browse structure collections

About this viewer

MolViewer shows 2QDF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.