E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2. Determined by X-ray diffraction at 2.15 Å resolution. Released 16 Apr 2025.
Explore 9CS1 in 3D Show helices and sheets RCSB PDB PDBe
9CS1 contains 9 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 424-433 | 10 | 1 |
| β-strand | 437-446 | 10 | 1 |
| α-helix | 449-451 | 3 | |
| β-strand | 455-462 | 8 | 1 |
| β-strand | 466-475 | 10 | 1 |
| β-strand | 484-495 | 12 | 1 |
| α-helix | 497-499 | 3 | |
| β-strand | 501 | 1 | 2 |
| β-strand | 505-518 | 14 | 1 |
| β-strand | 523-537 | 15 | 1 |
| α-helix | 539-541 | 3 | |
| β-strand | 542 | 1 | 3 |
| α-helix | 543-551 | 9 | |
| β-strand | 564-579 | 16 | 1 |
| β-strand | 590-600 | 11 | 1 |
| α-helix | 601 | 1 | |
| β-strand | 608-620 | 13 | 1 |
| β-strand | 628-640 | 13 | 1 |
| α-helix | 644-647 | 4 | |
| α-helix | 648-650 | 3 | |
| β-strand | 652 | 1 | 4 |
| β-strand | 662-663 | 2 | 5 |
| β-strand | 671 | 1 | 2 |
| β-strand | 674 | 1 | 3 |
| β-strand | 705 | 1 | 2 |
| β-strand | 708 | 1 | 4 |
| β-strand | 710-720 | 11 | 1 |
| α-helix | 721-722 | 2 | |
| β-strand | 733-745 | 13 | 1 |
| β-strand | 767-778 | 12 | 1 |
| β-strand | 781-792 | 12 | 1 |
| α-helix | 797-798 | 2 | |
| β-strand | 799-800 | 2 | 5 |
| β-strand | 802-806 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Outer membrane protein assembly factor BamA | A | protein | 390 | Escherichia coli | P0A940 (AlphaFold model) |
| Cyclic peptide CP2 | C | protein | 17 | synthetic construct | |
| Darobactin A | D | protein | 7 | Photorhabdus khanii |
>9CS1_1 Outer membrane protein assembly factor BamA (chains A) MNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTV RGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFIT PTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPL GPLVFSYAQPFKKYDGDKAEQFQFNIGKTW
>9CS1_2 Cyclic peptide CP2 (chains C) XFSGRWXWPSRSVGCGX
>9CS1_3 Darobactin A (chains D) WNXSKSF
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4NE | tetrabutylphosphonium | C16 H36 P | 2 |
Antibacterial macrocyclic peptides reveal a distinct mode of BamA inhibition. Walker, M.E., Zhu, W., Peterson, J.H. et al. Nat Commun (2025) 16:3395-3395. DOI 10.1038/s41467-025-58086-w · PubMed
Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9CS1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.