6QGW: E.coli BamA beta-barrel

Name: PDB 6QGW: Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
Published: 2019-06-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6. Determined by X-ray diffraction at 1.94 Å resolution. Released 26 Jun 2019.

Method: X-ray diffraction
Resolution: 1.94 Å
Organisms: Escherichia coli O157:H7, Lama glama
Chains: 2
Atoms: 4,239
Mol. weight: 64.02 kDa
Ligands: C8E
Released: 26 Jun 2019

Explore 6QGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QGW contains 16 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	427-433	7	1
β-strand	437-446	10	1
α-helix	449-451	3
β-strand	455-462	8	1
β-strand	466-475	10	1
β-strand	484-495	12	1
α-helix	496-499	4
β-strand	501	1	2
β-strand	505-520	16	1
β-strand	523-537	15	1
α-helix	539-541	3
β-strand	542	1	2
α-helix	543-551	9
β-strand	564-579	16	1
β-strand	590-600	11	1
β-strand	608-620	13	1
β-strand	628-640	13	1
α-helix	648-650	3
β-strand	652	1	3
β-strand	662-663	2	4
α-helix	664	1
β-strand	671-674	4	2
α-helix	675-677	3
β-strand	700-705	6	2
β-strand	708	1	3
β-strand	710-720	11	1
α-helix	721-722	2
α-helix	725-726	2
α-helix	730-732	3
β-strand	733-745	13	1
α-helix	751-753	3
β-strand	767-778	12	1
β-strand	781-792	12	1
α-helix	797-798	2
β-strand	799-800	2	4
β-strand	802-806	5	1

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	5
β-strand	12-14	3	6
β-strand	19-25	7	5
α-helix	30-32	3
β-strand	34-40	7	1
β-strand	47-52	6	1
β-strand	58-61	4	1
α-helix	63-65	3
β-strand	69-74	6	5
β-strand	79-84	6	5
α-helix	89-91	3
β-strand	93-100	8	1
α-helix	105-107	3
β-strand	112-113	2	1
β-strand	117-119	3	1
β-strand	120-122	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor BamA	A	protein	411	Escherichia coli O157:H7	P0A940 (AlphaFold model)
NanoE6	B	protein	123	Lama glama

Sequence of entity 1 (A), FASTA

>6QGW_1 Outer membrane protein assembly factor BamA (chains A)
MGSSHHHHHHSSGENLYFQHMRNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGIN
GTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPI
NEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYN
KLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGD
GLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYESATQDGAKDL
SKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPD
YSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW

Sequence of entity 2 (B), FASTA

>6QGW_2 NanoE6 (chains B)
SQMQLVESGGGLVQAGGSLTLSCAASGRTFSDYDMGWFRQAPGKAREFVARISRSGRMTS
LADSVKGRFTISRDNGKRTVYLQMNSLKPEDTAVYYCAADPQWSRVRSGADYWGQGTRVT
VSA

Ligands and cofactors

ID	Name	Formula	Copies
C8E	(hydroxyethyloxy)tri(ethyloxy)octane	C16 H34 O5	15

Primary citation

Identification of conformation-selective nanobodies against the membrane protein insertase BamA by an integrated structural biology approach. Kaur, H., Hartmann, J.B., Jakob, R.P. et al. J Biomol NMR (2019) 73:375-384. DOI 10.1007/s10858-019-00250-8 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A
6QGY 2.51 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody B12

Browse structure collections

About this viewer

MolViewer shows 6QGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.