7R1V: E.coli BamA beta-barrel

Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Sept 2022.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Escherichia coli O157:H7, Photorhabdus australis
Chains: 2
Atoms: 3,063
Mol. weight: 45.12 kDa
Released: 28 Sept 2022

Explore 7R1V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7R1V contains 11 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	424-433	10	1
β-strand	437-446	10	1
β-strand	455-462	8	1
β-strand	466-475	10	1
β-strand	484-495	12	1
α-helix	496-499	4
β-strand	501	1	2
β-strand	505-520	16	1
β-strand	523-537	15	1
β-strand	542	1	3
α-helix	543-551	9
β-strand	564-579	16	1
β-strand	590-600	11	1
α-helix	601	1
β-strand	608-620	13	1
β-strand	628-640	13	1
α-helix	644-647	4
α-helix	648-650	3
β-strand	652	1	4
β-strand	662-663	2	5
α-helix	664	1
β-strand	671	1	2
β-strand	674	1	3
α-helix	675-676	2
α-helix	699	1
β-strand	700	1	3
α-helix	701	1
β-strand	705	1	2
β-strand	708	1	4
β-strand	710-720	11	1
α-helix	721-722	2
α-helix	727-729	3
β-strand	733-745	13	1
β-strand	767-778	12	1
β-strand	781-792	12	1
β-strand	799-800	2	5
β-strand	802-807	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-9	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor BamA	A	protein	392	Escherichia coli O157:H7	P0A940 (AlphaFold model)
Dynobactin A	B	protein	10	Photorhabdus australis	A0A1C0U7H2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7R1V_1 Outer membrane protein assembly factor BamA (chains A)
HMRNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYF
TVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSN
MQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGK
VTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSS
TVRGFQSNTIGPKAVYFPHQASNYDPDYDYESATQDGAKDLSKSDDAVGGNAMAVASLEF
ITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMS
PLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW

Sequence of entity 2 (B), FASTA

>7R1V_2 Dynobactin A (chains B)
WNSNVHSYRF

Primary citation

Computational identification of a systemic antibiotic for gram-negative bacteria. Miller, R.D., Iinishi, A., Modaresi, S.M. et al. Nat Microbiol (2022) 7:1661-1672. DOI 10.1038/s41564-022-01227-4 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
6QGY 2.51 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody B12

Browse structure collections

About this viewer

MolViewer shows 7R1V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.