Solution structure of the human DDEF1 SH3 domain. Determined by solution NMR. Released 7 Jul 2010.
Explore 2RQT in 3D Show helices and sheets RCSB PDB PDBe
2RQT contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1071-1074 | 4 | 1 |
| β-strand | 1078 | 1 | 2 |
| β-strand | 1085 | 1 | 1 |
| β-strand | 1088 | 1 | 2 |
| β-strand | 1093-1099 | 7 | 1 |
| β-strand | 1104-1109 | 6 | 1 |
| β-strand | 1112-1120 | 9 | 1 |
| α-helix | 1121-1123 | 3 | |
| β-strand | 1124-1127 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 | A | protein | 61 | Homo sapiens | Q9ULH1 (AlphaFold model) |
>2RQT_1 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (chains A) VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILS D
Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain. Kaieda, S., Matsui, C., Mimori-Kiyosue, Y. et al. Biochemistry (2010) 49:5143-5153. DOI 10.1021/bi100563z · PubMed
Other PDB entries of the same protein (UniProt Q9ULH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.