2UWN: Human complement factor H

Crystal structure of Human Complement Factor H, SCR domains 6-8 (H402 risk variant), in complex with ligand. Determined by X-ray diffraction at 2.35 Å resolution. Released 2 Oct 2007.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,755
Mol. weight: 22.55 kDa
Released: 2 Oct 2007

Explore 2UWN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UWN contains 7 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	325	1	1
β-strand	333-335	3	2
α-helix	338-341	4
β-strand	347	1	1
β-strand	352-357	6	2
β-strand	361-362	2	3
β-strand	369-375	7	2
β-strand	378-380	3	2
β-strand	386-387	2	3
β-strand	388-390	3	4
α-helix	391-393	3
β-strand	397-398	2	5
β-strand	405-407	3	4
β-strand	411-413	3	6
β-strand	415-416	2	5
α-helix	417	1
β-strand	420-421	2	7
β-strand	428-432	5	6
β-strand	435-437	3	6
α-helix	442	1
β-strand	443-444	2	7
α-helix	445-446	2
β-strand	447-449	3	8
α-helix	450-452	3
β-strand	458-459	2	9
β-strand	466-468	3	8
β-strand	472-477	6	9
α-helix	478	1
β-strand	489-493	5	9
β-strand	494-495	2	10
β-strand	498-499	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human complement factor H	A	protein	187	HOMO SAPIENS	P08603 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2UWN_1 HUMAN COMPLEMENT FACTOR H (chains A)
MGLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGW
SPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPT
PRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGW
SAQPTCI

Primary citation

Structural Basis for Complement Factor H Linked Age-Related Macular Degeneration. Prosser, B.E., Johnson, S., Roversi, P. et al. J Exp Med (2007) 204:2277. DOI 10.1084/JEM.20071069 · PubMed

Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4K12 1.08 Å, Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae
3R62 1.52 Å, Structure of complement regulator Factor H mutant, T1184R.
3KZJ 1.65 Å, Structure of complement Factor H variant R1203A
2G7I 1.75 Å, Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for…
3SW0 1.8 Å, Structure of the C-terminal region (modules 18-20) of complement regulator Factor H
6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
9MLU 1.82 Å, FbaA with Factor H 6-7 domain
9MMX 1.9 Å, M6 protein with Factor H 6-7 domain
3KXV 2.0 Å, Structure of complement Factor H variant Q1139A
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
6ZH1 2.2 Å, Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii

Browse structure collections

About this viewer

MolViewer shows 2UWN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.