Structure of complement Factor H variant R1203A. Determined by X-ray diffraction at 1.65 Å resolution. Released 19 May 2010.
Explore 3KZJ in 3D Show helices and sheets RCSB PDB PDBe
3KZJ contains 8 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1109 | 1 | 1 |
| α-helix | 1112-1114 | 3 | |
| β-strand | 1118-1120 | 3 | 2 |
| β-strand | 1128 | 1 | 1 |
| β-strand | 1133-1135 | 3 | 3 |
| β-strand | 1136-1138 | 3 | 2 |
| α-helix | 1142 | 1 | |
| β-strand | 1143-1145 | 3 | 4 |
| β-strand | 1149-1151 | 3 | 3 |
| β-strand | 1152-1153 | 2 | 5 |
| β-strand | 1156-1157 | 2 | 5 |
| α-helix | 1159-1161 | 3 | |
| β-strand | 1162-1164 | 3 | 4 |
| α-helix | 1165-1166 | 2 | |
| β-strand | 1167-1168 | 2 | 6 |
| α-helix | 1171-1176 | 6 | |
| β-strand | 1179-1181 | 3 | 7 |
| β-strand | 1190-1191 | 2 | 6 |
| β-strand | 1196-1198 | 3 | 8 |
| β-strand | 1199-1201 | 3 | 7 |
| α-helix | 1202 | 1 | |
| β-strand | 1206-1207 | 2 | 9 |
| α-helix | 1208 | 1 | |
| α-helix | 1211-1213 | 3 | |
| β-strand | 1215-1217 | 3 | 8 |
| β-strand | 1219 | 1 | 10 |
| β-strand | 1222 | 1 | 10 |
| β-strand | 1228-1229 | 2 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Complement factor H | A | protein | 133 | Homo sapiens | P08603 (AlphaFold model) |
>3KZJ_1 Complement factor H (chains A) AGIQKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWS EPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKAGYRLSSRSHTLRTTC WDGKLEYPTCAKR
Both domain 19 and domain 20 of factor H are involved in binding to complement C3b and C3d. Bhattacharjee, A., Lehtinen, M.J., Kajander, T. et al. Mol Immunol (2010) 47:1686-1691. DOI 10.1016/j.molimm.2010.03.007 · PubMed
Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3KZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.