4K12: Complement factor H

Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae. Determined by X-ray diffraction at 1.08 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 1.08 Å
Organisms: Homo sapiens, Streptococcus pneumoniae
Chains: 2
Atoms: 1,483
Mol. weight: 17.01 kDa
Released: 9 Apr 2014

Explore 4K12 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4K12 contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	1-3	3
β-strand	4-6	3	1
α-helix	7-10	4
β-strand	11	1	2
β-strand	13-14	2	3
β-strand	21-23	3	1
β-strand	27-32	6	3
α-helix	33	1
β-strand	36-37	2	4
β-strand	44-48	5	3
β-strand	49-50	2	5
β-strand	53-54	2	5
β-strand	59	1	2
β-strand	61-62	2	4

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-26	25
α-helix	32-54	23
α-helix	59-78	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor H	A	protein	64	Homo sapiens	P08603 (AlphaFold model)
Choline binding protein A	B	protein	84	Streptococcus pneumoniae	G6W2B2

Sequence of entity 1 (A), FASTA

>4K12_1 Complement factor H (chains A)
GSHMSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPI
CYER

Sequence of entity 2 (B), FASTA

>4K12_2 Choline binding protein A (chains B)
GHMDSERDKARKEVEEYVKKIVGESYAKSTKKRHTITVALVNELNNIKNEYLNKIVESTS
ESELQILMMESRSKVDEAVSKFEK

Primary citation

Structural determinants of host specificity of complement Factor H recruitment by Streptococcus pneumoniae. Achila, D., Liu, A., Banerjee, R. et al. Biochem J (2015) 465:325-335. DOI 10.1042/BJ20141069 · PubMed

Other PDB entries of the same protein (UniProt P08603 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R62 1.52 Å, Structure of complement regulator Factor H mutant, T1184R.
3KZJ 1.65 Å, Structure of complement Factor H variant R1203A
2G7I 1.75 Å, Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for…
3SW0 1.8 Å, Structure of the C-terminal region (modules 18-20) of complement regulator Factor H
6ATG 1.8 Å, Insights to complement factor H recruitment by the borrelial CspZ protein as revealed by…
9MLU 1.82 Å, FbaA with Factor H 6-7 domain
9MMX 1.9 Å, M6 protein with Factor H 6-7 domain
3KXV 2.0 Å, Structure of complement Factor H variant Q1139A
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
6ZH1 2.2 Å, Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii
4ZH1 2.24 Å, Complement factor H in complex with the GM1 glycan

Browse structure collections

About this viewer

MolViewer shows 4K12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.