2W2C: PDB entry 2W2C

Structure of the tetradecameric oligomerisation domain of calcium- calmodulin dependent protein kinase II delta. Determined by X-ray diffraction at 2.7 Å resolution. Released 23 Dec 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: HOMO SAPIENS
Chains: 14
Atoms: 14,067
Mol. weight: 231.3 kDa
Ligands: CD
Released: 23 Dec 2008

Explore 2W2C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W2C contains 68 α-helices and 84 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	340-363	24
α-helix	366-372	7
β-strand	373-380	8	1
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	1
α-helix	393-401	9
β-strand	410-421	12	1
β-strand	426-438	13	1
β-strand	444-458	15	1
β-strand	461-470	10	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	341-363	23
α-helix	366-372	7
β-strand	373-380	8	2
α-helix	382-384	3
β-strand	388-390	3	2
α-helix	393-401	9
β-strand	411-421	11	2
β-strand	426-438	13	2
β-strand	444-458	15	2
β-strand	461-470	10	2

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-363	22
α-helix	366-372	7
β-strand	373-380	8	3
α-helix	382-384	3
β-strand	389-390	2	3
α-helix	393-400	8
β-strand	411-421	11	3
β-strand	426-438	13	3
β-strand	444-458	15	3
β-strand	461-470	10	3

Chain D: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	343-363	21
α-helix	366-372	7
β-strand	373-380	8	4
α-helix	382-384	3
α-helix	387	1
β-strand	388-390	3	4
α-helix	393-401	9
β-strand	410-421	12	4
β-strand	426-438	13	4
β-strand	444-458	15	4
β-strand	461-470	10	4

Chain E: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	339-363	25
α-helix	366-372	7
β-strand	373-380	8	5
α-helix	382-384	3
α-helix	387	1
β-strand	388-390	3	5
α-helix	393-401	9
β-strand	411-421	11	5
β-strand	426-438	13	5
β-strand	444-458	15	5
β-strand	461-470	10	5

Chains F and G: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	342-363	22
α-helix	366-372	7
β-strand	373-380	8	6
α-helix	382-384	3
α-helix	387	1
β-strand	388-390	3	6
α-helix	393-401	9
β-strand	410-421	12	6
β-strand	426-438	13	6
β-strand	444-458	15	6
β-strand	461-470	10	6

Chain H: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	340-363	24
α-helix	366-372	7
β-strand	373-380	8	8
α-helix	382-384	3
α-helix	387-388	2
β-strand	389-390	2	8
α-helix	393-401	9
β-strand	411-421	11	8
β-strand	426-438	13	8
β-strand	444-458	15	8
β-strand	461-470	10	8

Chain I: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	340-363	24
α-helix	366-372	7
β-strand	373-380	8	9
α-helix	382-384	3
α-helix	387	1
β-strand	388-390	3	9
α-helix	393-401	9
β-strand	410-421	12	9
β-strand	426-438	13	9
β-strand	444-458	15	9
β-strand	461-470	10	9

5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II delta chain	A, B, C, D, E, F, G, H, I, J, K, L, M, N	protein	144	HOMO SAPIENS	Q13557 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N), FASTA

>2W2C_1 CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE II DELTA CHAIN (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N)
SMSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEG
MDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEE
TRVWHRRDGKWQNVHFHRSGSPTV

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	6

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation. Rellos, P., Pike, A.C.W., Niesen, F.H. et al. PLoS Biol (2010) 8:426. DOI 10.1371/JOURNAL.PBIO.1000426 · PubMed

Other PDB entries of the same protein (UniProt Q13557 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GP2 1.46 Å, Calmodulin bound to peptide from calmodulin kinase II (CaMKII)
7ZRQ 1.68 Å, 1.68 Angstrom crystal structure of Ca/CaM-E140G:CaMKIIdelta peptide complex
2WEL 1.9 Å, Crystal structure of SU6656-bound calcium/calmodulin-dependent protein kinase II delta…
5VLO 2.05 Å, The structure of human CamKII with bound inhibitor
6AYW 2.05 Å, The structure of human CamKII with bound inhibitor
2VN9 2.3 Å, Crystal Structure of Human Calcium Calmodulin dependent Protein Kinase II delta isoform…
9BLH 2.35 Å, Crystal structure of calcium/calmodulin-dependent protein kinase type II subunit delta…
7ZRP 2.65 Å, 2.65 Angstrom crystal structure of Ca/CaM:CaMKIIdelta peptide complex

Browse structure collections

About this viewer

MolViewer shows 2W2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.