1.68 Angstrom crystal structure of Ca/CaM-E140G:CaMKIIdelta peptide complex. Determined by X-ray diffraction at 1.68 Å resolution. Released 28 Dec 2022.
Explore 7ZRQ in 3D Show helices and sheets RCSB PDB PDBe
7ZRQ contains 9 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-19 | 16 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 29-38 | 10 | |
| α-helix | 45-55 | 11 | |
| β-strand | 63 | 1 | 1 |
| α-helix | 65-74 | 10 | |
| α-helix | 81-92 | 12 | |
| β-strand | 99-100 | 2 | 2 |
| α-helix | 102-111 | 10 | |
| α-helix | 118-128 | 11 | |
| β-strand | 136-137 | 2 | 2 |
| α-helix | 138-146 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-18 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calmodulin-1 | A | protein | 148 | Homo sapiens | P0DP23 (AlphaFold model) |
| Calcium/calmodulin-dependent protein kinase type II subunit delta | B | protein | 22 | Homo sapiens | Q13557 (AlphaFold model) |
>7ZRQ_1 Calmodulin-1 (chains A) ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE VDEMIREADIDGDGQVNYEGFVQMMTAK
>7ZRQ_2 Calcium/calmodulin-dependent protein kinase type II subunit delta (chains B) FNARRKLKGAILTTMLATRNFS
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 4 |
Water and common crystallization additives (GOL) are not listed.
Calmodulin variant E140G associated with long QT syndrome impairs CaMKII delta autophosphorylation and L-type calcium channel inactivation. Prakash, O., Gupta, N., Milburn, A. et al. J Biol Chem (2022) 299:102777-102777. DOI 10.1016/j.jbc.2022.102777 · PubMed
Other PDB entries of the same protein (UniProt P0DP23 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ZRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.