5VLO: Human CamKII with bound inhibitor

The structure of human CamKII with bound inhibitor. Determined by X-ray diffraction at 2.05 Å resolution. Released 23 Aug 2017.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,137
Mol. weight: 70.32 kDa
Ligands: DTT, 9EJ
Released: 23 Aug 2017

Explore 5VLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VLO contains 34 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-13	5
β-strand	14-19	6	1
β-strand	27-33	7	1
β-strand	39-46	8	1
α-helix	52-67	16
β-strand	73	1	2
β-strand	76-81	6	1
β-strand	85-91	7	1
β-strand	97	1	2
α-helix	98-102	5
α-helix	110-129	20
β-strand	132-133	2	3
α-helix	139-141	3
β-strand	142-144	3	2
α-helix	147-149	3
β-strand	153-155	3	2
β-strand	162-163	2	3
β-strand	170	1	4
α-helix	178-180	3
α-helix	183-186	4
β-strand	191	1	4
α-helix	194-209	16
α-helix	219-228	10
α-helix	237-240	4
α-helix	243-252	10
α-helix	261-262	2
α-helix	263-266	4
α-helix	270-273	4
α-helix	275-278	4
α-helix	285-298	14

Chain B: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-13	5
β-strand	14-22	9	5
β-strand	27-33	7	5
β-strand	39-45	7	5
α-helix	47-49	3
α-helix	52-67	16
β-strand	73	1	6
β-strand	76-82	7	5
β-strand	85-91	7	5
β-strand	97	1	6
α-helix	98-102	5
α-helix	110-129	20
β-strand	132-133	2	7
α-helix	139-141	3
β-strand	142-144	3	6
α-helix	151-152	2
β-strand	153-155	3	6
β-strand	162-163	2	7
β-strand	170	1	8
α-helix	178-180	3
α-helix	183-186	4
β-strand	191	1	8
α-helix	194-209	16
α-helix	219-227	9
α-helix	243-252	10
α-helix	261-262	2
α-helix	263-266	4
α-helix	270-273	4
α-helix	275-278	4
α-helix	285-297	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II subunit delta	A, B	protein	302	Homo sapiens	Q13557 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5VLO_1 Calcium/calmodulin-dependent protein kinase type II subunit delta (chains A, B)
GHMSTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLE
REARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ
ILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPG
YLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWD
TVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRK
LK

Ligands and cofactors

ID	Name	Formula	Copies
DTT	2,3-dihydroxy-1,4-dithiobutane	C4 H10 O2 S2	2
9EJ	N-[(2S)-2-(diethylamino)propyl]-2-[(2S)-2-(methylcarbamoyl)azetidin-1-yl]-6-[5-…	C28 H34 N8 O2 S	2

Primary citation

Inhibitors of CamKII. Somoza, T.J., Villasenor, A.G. To be published.

Other PDB entries of the same protein (UniProt Q13557 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GP2 1.46 Å, Calmodulin bound to peptide from calmodulin kinase II (CaMKII)
7ZRQ 1.68 Å, 1.68 Angstrom crystal structure of Ca/CaM-E140G:CaMKIIdelta peptide complex
2WEL 1.9 Å, Crystal structure of SU6656-bound calcium/calmodulin-dependent protein kinase II delta…
6AYW 2.05 Å, The structure of human CamKII with bound inhibitor
2VN9 2.3 Å, Crystal Structure of Human Calcium Calmodulin dependent Protein Kinase II delta isoform…
9BLH 2.35 Å, Crystal structure of calcium/calmodulin-dependent protein kinase type II subunit delta…
7ZRP 2.65 Å, 2.65 Angstrom crystal structure of Ca/CaM:CaMKIIdelta peptide complex
2W2C 2.7 Å, Structure of the tetradecameric oligomerisation domain of calcium- calmodulin dependent…

Browse structure collections

About this viewer

MolViewer shows 5VLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.