2W6B: Trimeric beta-PIX Coiled-Coil Domain

Crystal Structure of the Trimeric beta-PIX Coiled-Coil Domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 20 Jan 2009.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: RATTUS NORVEGICUS
Chains: 1
Atoms: 423
Mol. weight: 6.65 kDa
Released: 20 Jan 2009

Explore 2W6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W6B contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	588-636	49

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 7	A	protein	56	RATTUS NORVEGICUS	O55043 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2W6B_1 RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 7 (chains A)
GPLGSKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMND

Primary citation

Structures of Dimeric Git1 and Trimeric Beta-Pix and Implications for Git-Pix Complex Assembly. Schlenker, O., Rittinger, K. J Mol Biol (2009) 386:280. DOI 10.1016/J.JMB.2008.12.050 · PubMed

Other PDB entries of the same protein (UniProt O55043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G6F 0.92 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2DF6 1.3 Å, Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide…
2AK5 1.85 Å, beta PIX-SH3 complexed with a Cbl-b peptide
2P4R 2.0 Å, Structural basis for a novel interaction between AIP4 and beta-PIX
3QJN 2.71 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
3L4F 2.8 Å, Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex

Browse structure collections

About this viewer

MolViewer shows 2W6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.