2WQA: Complex of TTR and RBP4 and Oleic Acid

Complex of TTR and RBP4 and Oleic Acid. Determined by X-ray diffraction at 2.85 Å resolution. Released 1 Sept 2010.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 6,597
Mol. weight: 97.87 kDa
Ligands: OLA
Released: 1 Sept 2010

Explore 2WQA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WQA contains 14 α-helices and 69 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	2
β-strand	41-48	8	2
β-strand	54-55	2	1
β-strand	67-73	7	2
α-helix	75-80	6
β-strand	91-97	7	2
β-strand	104	1	3
β-strand	105-112	8	1
β-strand	115-120	6	1
β-strand	123	1	3

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	4
β-strand	41-48	8	4
β-strand	54-55	2	1
β-strand	67-73	7	4
α-helix	75-80	6
β-strand	84	1	5
β-strand	88-90	3	2
β-strand	91-97	7	4
β-strand	104-112	9	1
β-strand	115-123	9	1

Chain D: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	6
β-strand	23-24	2	6
β-strand	29-35	7	9
β-strand	41-48	8	9
β-strand	54	1	6
β-strand	67-73	7	9
α-helix	75-80	6
β-strand	84	1	10
β-strand	88-90	3	7
β-strand	91-97	7	9
β-strand	104-112	9	6
β-strand	115-123	9	6

Chain E: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	11
α-helix	6-8	3
α-helix	17-20	4
β-strand	22-30	9	12
β-strand	37-47	11	12
β-strand	53-55	3	12
β-strand	58-63	6	12
β-strand	67-78	12	12
β-strand	85-92	8	12
β-strand	97	1	10
β-strand	100-109	10	12
β-strand	114-123	10	12
β-strand	128	1	11
β-strand	129-138	10	12
α-helix	146-158	13
α-helix	165	1
β-strand	166-167	2	12
α-helix	168-169	2

Chain F: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	13
α-helix	6-8	3
β-strand	22-30	9	14
α-helix	31-32	2
β-strand	37-47	11	14
β-strand	53-63	11	14
β-strand	67-78	12	14
β-strand	85-92	8	14
β-strand	97	1	5
β-strand	100-109	10	14
β-strand	114-123	10	14
β-strand	128	1	13
β-strand	129-138	10	14
α-helix	146-158	13
α-helix	165	1
β-strand	166-167	2	14
α-helix	168-169	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transthyretin	A, B, C, D	protein	129	HOMO SAPIENS	P02766 (AlphaFold model)
Retinol-binding protein 4	E, F	protein	177	HOMO SAPIENS	P02753 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2WQA_1 TRANSTHYRETIN (chains A, B, C, D)
GSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGL
TTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYST
TAVVTNPKE

Sequence of entity 2 (E, F), FASTA

>2WQA_2 RETINOL-BINDING PROTEIN 4 (chains E, F)
GERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKG
RVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYS
CRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDG

Ligands and cofactors

ID	Name	Formula	Copies
OLA	Oleic acid	C18 H34 O2	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal Structure of Rbp4 Bound to Linoleic Acid and Ttr. Nanao, M., Stout, T.J. To be published.

Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F86 1.1 Å, Transthyretin THR119MET protein stabilisation
8C86 1.1 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 2
8W45 1.1 Å, X-ray crystal structure of V30M-TTR in complex with pinostilbene
4QXV 1.12 Å, Crystal structure of human transthyretin in complex with luteolin at 1.1 a resolution
4KY2 1.13 Å, Transthyretin in complex with the fluorescent folding sensor…
4D7B 1.15 Å, Structure of human transthyretin in complex with Tolcapone
7EJQ 1.15 Å, Crystal structure of human transthyretin in complex with…
8AWI 1.15 Å, Crystal structure of Human Transthyretin at 1.15 Angstrom resolution
6TXW 1.15 Å, V30G Transthyretin structure in complex with Tolcalpone
4L1T 1.16 Å, Transthyretin in complex with (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzo…
4HIQ 1.18 Å, The Structure of V122I Mutant Transthyretin in Complex with AG10
9H7L 1.18 Å, Human Transthyretin in Complex with 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine

Browse structure collections

About this viewer

MolViewer shows 2WQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.