2WT8: N-terminal BRCT domain of human microcephalin

Structure of the N-terminal BRCT domain of human microcephalin (Mcph1). Determined by X-ray diffraction at 1.6 Å resolution. Released 1 Dec 2009.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,433
Mol. weight: 43.43 kDa
Released: 1 Dec 2009

Explore 2WT8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WT8 contains 20 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
β-strand	10-15	6	1
β-strand	16	1	2
β-strand	23	1	2
α-helix	25-34	10
β-strand	38-39	2	1
β-strand	49-53	5	1
α-helix	57-66	10
β-strand	69-71	3	1
α-helix	73-82	10
α-helix	88-90	3
β-strand	92	1	1

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	10-15	6	3
β-strand	16	1	4
β-strand	23	1	4
α-helix	25-34	10
β-strand	38-39	2	3
β-strand	49-53	5	3
α-helix	57-66	10
β-strand	69-71	3	3
α-helix	73-82	10
α-helix	88-90	3
β-strand	92	1	3

Chain C: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	5
β-strand	16	1	6
β-strand	23	1	6
α-helix	25-34	10
β-strand	38-39	2	5
β-strand	49-53	5	5
α-helix	57-66	10
β-strand	69-71	3	5
α-helix	73-82	10
α-helix	88-90	3
β-strand	92	1	5

Chain D: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	7
β-strand	16	1	8
β-strand	23	1	8
α-helix	25-28	4
α-helix	29-33	5
β-strand	38-40	3	7
β-strand	49-53	5	7
α-helix	57-66	10
α-helix	68	1
β-strand	69-71	3	7
α-helix	73-82	10
α-helix	88-90	3
β-strand	92	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microcephalin	A, B, C, D	protein	97	HOMO SAPIENS	Q8NEM0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2WT8_1 MICROCEPHALIN (chains A, B, C, D)
GAMAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQS
TWDKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPAAN

Primary citation

A Pocket on the Surface of the N-Terminal Brct Domain of Mcph1 is Required to Prevent Abnormal Chromosome Condensation. Richards, M.W., Leung, J.W.C., Roe, S.M. et al. J Mol Biol (2010) 395:908. DOI 10.1016/J.JMB.2009.11.029 · PubMed

Other PDB entries of the same protein (UniProt Q8NEM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PA6 1.5 Å, Structure of the N-terminal BRCT domain of human microcephalin (MCPH1)
3U3Z 1.5 Å, Structure of human microcephalin (MCPH1) tandem BRCT domains in complex with an H2A.X…
3KTF 1.6 Å, Structure of the N-terminal BRCT domain of human microcephalin (MCPH1).
3SHT 1.95 Å, Crystal structure of human MCPH1 tandem BRCT domains
3SHV 2.1 Å, Crystal structure of human MCPH1 tandem BRCT domains-gamma H2AX complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
3T1N 2.6 Å, Structure of human MICROCEPHALIN (MCPH1) TANDEM BRCT domains in complex with a CDC27…
3SZM 2.63 Å, Structure of human microcephalin (MCPH1) tandem brct domains in complex with a…

Browse structure collections

About this viewer

MolViewer shows 2WT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.