2X4M: Yersinia Pestis Plasminogen Activator Pla

Yersinia Pestis Plasminogen Activator Pla. Determined by X-ray diffraction at 2.55 Å resolution. Released 28 Jul 2010.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: YERSINIA PESTIS
Chains: 4
Atoms: 9,482
Mol. weight: 138.32 kDa
Ligands: C8E
Released: 28 Jul 2010

Explore 2X4M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X4M contains 6 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 18 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	15-32	18	2
β-strand	39-57	19	2
β-strand	60	1	1
β-strand	62	1	2
β-strand	65-74	10	2
β-strand	78-80	3	2
β-strand	83-86	4	2
β-strand	97-100	4	2
β-strand	105-122	18	2
β-strand	126-144	19	2
β-strand	147-150	4	2
α-helix	151-153	3
β-strand	155-158	4	2
β-strand	164-185	22	2
β-strand	187-208	22	2
β-strand	213-236	24	2
β-strand	239-261	23	2
β-strand	267-291	25	2

Chain B: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	14-32	19	3
β-strand	39-55	17	3
β-strand	58-62	5	3
β-strand	65-74	10	3
β-strand	78-86	9	3
β-strand	97-100	4	3
β-strand	103-122	20	3
β-strand	127-144	18	3
β-strand	147-150	4	3
β-strand	155-158	4	3
α-helix	159-160	2
β-strand	164-185	22	3
β-strand	188-208	21	3
α-helix	209-211	3
β-strand	213-234	22	3
β-strand	239-261	23	3
β-strand	267-291	25	3

Chain C: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	14-32	19	4
β-strand	39-62	24	4
β-strand	65-74	10	4
β-strand	78-86	9	4
β-strand	97-100	4	4
β-strand	103-123	21	4
β-strand	126-144	19	4
β-strand	147-150	4	4
β-strand	155-158	4	4
α-helix	159-160	2
β-strand	164-184	21	4
β-strand	189-208	20	4
β-strand	213-234	22	4
β-strand	239-261	23	4
β-strand	266-291	26	4

Chain D: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	14-32	19	5
β-strand	39-59	21	5
β-strand	65-74	10	5
β-strand	78-86	9	5
β-strand	97-100	4	5
β-strand	103-119	17	5
β-strand	126-144	19	5
β-strand	147-150	4	5
β-strand	155-158	4	5
α-helix	159-160	2
β-strand	164-185	22	5
β-strand	188-208	21	5
α-helix	209-211	3
β-strand	213-236	24	5
β-strand	239-261	23	5
β-strand	267-292	26	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulase/fibrinolysin	A, B, C, D	protein	298	YERSINIA PESTIS	P17811 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2X4M_1 COAGULASE/FIBRINOLYSIN (chains A, B, C, D)
ASSQLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWD
PYSFLTLNARGWTSLASGSGNMDDYAWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWL
LQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLA
GQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAK
VFAEFTYSKYDEGKGGTQTIDKNSGDSVSIGGDAAGISNKNYTVTAGLQYRFGGGGGG

Ligands and cofactors

ID	Name	Formula	Copies
C8E	(hydroxyethyloxy)tri(ethyloxy)octane	C16 H34 O5	14

Water and common crystallization additives (SO4) are not listed.

Primary citation

An Active Site Water Network in the Plasminogen Activator Pla from Yersinia Pestis. Eren, E., Murphy, M., Goguen, J. et al. Structure (2010) 18:809. DOI 10.1016/J.STR.2010.03.013 · PubMed

Other PDB entries of the same protein (UniProt P17811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2X55 1.85 Å, Yersinia Pestis Plasminogen Activator Pla (Native)
4DCB 2.03 Å, Y. pestis Plasminogen Activator Pla in Complex with Human Plasminogen Activation Loop…
2X56 2.3 Å, Yersinia Pestis Plasminogen Activator Pla (Native)

Browse structure collections

About this viewer

MolViewer shows 2X4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.