Crystal structures exploring the origins of the broader specificity of escherichia coli heat-labile enterotoxin compared to cholera toxin. Determined by X-ray diffraction at 2.4 Å resolution. Released 8 Dec 2010.
Explore 2XRQ in 3D Show helices and sheets RCSB PDB PDBe
2XRQ contains 20 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-78 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 95-102 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-77 | 17 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-78 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 95-102 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat-labile enterotoxin B chain | D, E, F, G, H | protein | 103 | ESCHERICHIA COLI | P32890 (AlphaFold model) |
>2XRQ_1 HEAT-LABILE ENTEROTOXIN B CHAIN (chains D, E, F, G, H) APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Crystal Structures Exploring the Origins of the Broader Specificity of Escherichia Coli Heat-Labile Enterotoxin Compared to Cholera Toxin. Holmner, A., Mackenzie, A., Okvist, M. et al. J Mol Biol (2011) 406:387. DOI 10.1016/J.JMB.2010.11.060 · PubMed
Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2XRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.