Crystal structure of the rhogap domain of human PIK3R2. Determined by X-ray diffraction at 2.09 Å resolution. Released 17 Nov 2010.
Explore 2XS6 in 3D Show helices and sheets RCSB PDB PDBe
2XS6 contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 110-113 | 4 | |
| α-helix | 114-117 | 4 | |
| α-helix | 126-138 | 13 | |
| α-helix | 144-146 | 3 | |
| α-helix | 150-154 | 5 | |
| α-helix | 162-164 | 3 | |
| α-helix | 167-180 | 14 | |
| α-helix | 188-199 | 12 | |
| α-helix | 206-209 | 4 | |
| α-helix | 216-235 | 20 | |
| α-helix | 239-255 | 17 | |
| α-helix | 279-293 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase regulatory subunit beta | A | protein | 214 | HOMO SAPIENS | O00459 (AlphaFold model) |
>2XS6_1 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNIT BETA (chains A) MHHHHHHSSGVDLGTENLYFQSMGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSES HYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGP VGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALGPAVRALGATFGPLLLRAPPPPSSP PPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVA
The Structure and Catalytic Mechanism of Human Sphingomyelin Phosphodiesterase Like 3A - an Acid Sphingomyelinase Homolog with a Novel Nucleotide Hydrolase Activity. Lim, S.M., Yeung, K., Tresaugues, L. et al. FEBS J (2016) 283:1107. DOI 10.1111/FEBS.13655 · PubMed
Other PDB entries of the same protein (UniProt O00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2XS6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.