2XVT: Extracellular domain of human RAMP2

Structure of the extracellular domain of human RAMP2. Determined by X-ray diffraction at 2.05 Å resolution. Released 29 Dec 2010.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 4,177
Mol. weight: 65.36 kDa
Ligands: CA
Released: 29 Dec 2010

Explore 2XVT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XVT contains 30 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	61-76	16
α-helix	77-82	6
α-helix	86-106	21
α-helix	114-123	10
α-helix	124-128	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor activity-modifying protein 2	A, B, C, D, E, F	protein	94	HOMO SAPIENS	O60895 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>2XVT_1 RECEPTOR ACTIVITY-MODIFYING PROTEIN 2 (chains A, B, C, D, E, F)
SMTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAE
LFDLGFPNPLAERIIFETHQIHFANCSLVQPTFS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Structure of the Extracellular Domain of Human Ramp2. Quigley, A., Pike, A.C.W., Burgess-Brown, N. et al. To be published.

Other PDB entries of the same protein (UniProt O60895 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RWF 1.76 Å, Crystal structure of the CLR:RAMP2 extracellular domain heterodimer with bound…
6V2E 1.83 Å, Crystal structure of the human CLR:RAMP2 extracellular domain heterodimer with bound…
3AQE 2.0 Å, Crystal structure of the extracellular domain of human RAMP2
7TYX 2.55 Å, Human Amylin2 Receptor in complex with Gs and rat amylin peptide
3AQF 2.6 Å, Crystal structure of the human CRLR/RAMP2 extracellular complex
9BQ3 2.8 Å, Human Amylin2 Receptor in Complex with Gs and Cagrilintide
6UUN 3.0 Å, CryoEM Structure of the active Adrenomedullin 1 receptor G protein complex with…
7TYY 3.0 Å, Human Amylin2 Receptor in complex with Gs and salmon calcitonin peptide
7TYH 3.3 Å, Human Amylin2 Receptor in complex with Gs and human calcitonin peptide

Browse structure collections

About this viewer

MolViewer shows 2XVT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.