2XWC: DNA binding domain of human TP73

Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution. Determined by X-ray diffraction at 1.82 Å resolution. Released 17 Nov 2010.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,784
Mol. weight: 23.73 kDa
Ligands: TAM, ZN
Released: 17 Nov 2010

Explore 2XWC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XWC contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	1
β-strand	128-130	3	2
β-strand	142-145	4	1
β-strand	150-153	4	1
β-strand	158-164	7	2
β-strand	174-181	8	1
β-strand	190	1	1
α-helix	191	1
α-helix	195-199	5
β-strand	215-218	4	2
β-strand	224-227	4	1
β-strand	234-239	6	1
β-strand	250-256	7	2
α-helix	260-262	3
β-strand	271-278	8	1
β-strand	284-294	11	1
α-helix	298-313	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumour protein P73	A	protein	208	HOMO SAPIENS	O15350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XWC_1 TUMOUR PROTEIN P73 (chains A)
MAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPP
PGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPV
TGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSF
EGRICACPGRDRKADEDHYREAENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
TAM	Tris(hydroxyethyl)aminomethane	C7 H17 N O3	1
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73. Canning, P., von Delft, F., Bullock, A.N. J Mol Biol (2012) 423:515. DOI 10.1016/J.JMB.2012.08.005 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…
8P9D 2.7 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…

Browse structure collections

About this viewer

MolViewer shows 2XWC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.