2Y9U: P63a SAM domain mutants involved in AEC syndrome

Structural basis of p63a SAM domain mutants involved in AEC syndrome. Determined by X-ray diffraction at 1.6 Å resolution. Released 3 Aug 2011.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 630
Mol. weight: 8 kDa
Released: 3 Aug 2011

Explore 2Y9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y9U contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	548	1	1
α-helix	549-554	6
α-helix	559-561	3
α-helix	562-566	5
β-strand	572	1	1
α-helix	573-576	4
α-helix	581-586	6
α-helix	591-609	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein 63	A	protein	69	HOMO SAPIENS	Q9H3D4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Y9U_1 TUMOR PROTEIN 63 (chains A)
GSTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGIL
DHRQLHEFS

Primary citation

Structural Basis of P63Alpha Sam Domain Mutants Involved in Aec Syndrome. Sathyamurthy, A., Freund, S.M.V., Johnson, C.M. et al. FEBS J (2011) 278:2680. DOI 10.1111/J.1742-4658.2011.08194.X · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1

Browse structure collections

About this viewer

MolViewer shows 2Y9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.