7Z71: P63 DBD

Crystal structure of p63 DBD in complex with darpin C14. Determined by X-ray diffraction at 1.85 Å resolution. Released 6 Jul 2022.

Method: X-ray diffraction
Resolution: 1.85 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 6,080
Mol. weight: 78.9 kDa
Ligands: ZN
Released: 6 Jul 2022

Explore 7Z71 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z71 contains 32 α-helices and 25 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	126-128	3
β-strand	132	1	1
β-strand	139-141	3	2
β-strand	153-156	4	1
β-strand	161-164	4	1
β-strand	170-175	6	2
α-helix	179-181	3
β-strand	185-192	8	1
α-helix	201-202	2
α-helix	206-210	5
β-strand	226-229	4	2
β-strand	235-238	4	1
β-strand	245-250	6	1
α-helix	253-255	3
β-strand	261-267	7	2
β-strand	282-289	8	1
β-strand	295-305	11	1
α-helix	309-319	11

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	17-25	9
α-helix	40-47	8
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-92	10
α-helix	106-113	8
α-helix	116-124	9
α-helix	139-145	7
α-helix	149-157	9

Chain C: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	126-128	3
β-strand	132	1	3
β-strand	139-141	3	4
β-strand	153-156	4	3
β-strand	161-164	4	3
β-strand	170-175	6	4
α-helix	179-181	3
β-strand	185-192	8	3
β-strand	201	1	3
α-helix	202	1
α-helix	206-210	5
β-strand	226-229	4	4
β-strand	235-238	4	3
β-strand	245-250	6	3
α-helix	253-255	3
β-strand	261-267	7	4
β-strand	282-289	8	3
β-strand	295-305	11	3
α-helix	309-319	11

Chain D: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	17-25	9
α-helix	40-47	8
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-91	9
α-helix	106-113	8
α-helix	116-124	9
α-helix	139-145	7
α-helix	149-158	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 4 of Tumor protein 63	A, C	protein	204	Homo sapiens	Q9H3D4 (AlphaFold model)
Darpin C14	B, D	protein	159	synthetic construct

Sequence of entity 1 (A, C), FASTA

>7Z71_1 Isoform 4 of Tumor protein 63 (chains A, C)
GSSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPP
PQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDP
ITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
FEARICACPGRDRKADEDSIRKQQ

Sequence of entity 2 (B, D), FASTA

>7Z71_2 Darpin C14 (chains B, D)
GSDLGKKLLEAAQIGQLDEVRILMANGADVNASDTDGLTPLHLAAASGHLEIVEVLLKTG
ADVNATDKWGDTPLHLAASQGHLEIVEVLLKAGADVNATDFTGNTPLHLAAYIGHLEIVE
VLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Designed Ankyrin Repeat Proteins as a tool box for analyzing p63. Strubel, A., Munick, P., Chaikuad, A. et al. Cell Death Differ (2022) 29:2445-2458. DOI 10.1038/s41418-022-01030-y · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1

Browse structure collections

About this viewer

MolViewer shows 7Z71 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.