7Z72: P63 SAM

Crystal structure of p63 SAM in complex with darpin A5. Determined by X-ray diffraction at 1.8 Å resolution. Released 6 Jul 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,900
Mol. weight: 24.93 kDa
Released: 6 Jul 2022

Explore 7Z72 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z72 contains 17 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	548	1	1
α-helix	549-556	8
α-helix	559-561	3
α-helix	562-566	5
β-strand	572	1	1
α-helix	573-576	4
α-helix	581-586	6
α-helix	591-593	3
α-helix	594-607	14

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	17-25	9
α-helix	40-47	8
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-91	9
α-helix	106-113	8
α-helix	116-124	9
α-helix	139-145	7
α-helix	149-155	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 9 of Tumor protein 63	A	protein	69	Homo sapiens	Q9H3D4 (AlphaFold model)
Darpin A5	B	protein	159	synthetic construct

Sequence of entity 1 (A), FASTA

>7Z72_1 Isoform 9 of Tumor protein 63 (chains A)
GSTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGIL
DHRQLHEFS

Sequence of entity 2 (B), FASTA

>7Z72_2 Darpin A5 (chains B)
GSDLGKKLLEAARAGQDDEVRILMANGADVNAQDQYGWTPLHLAAARGHLEIVEVLLKTG
ADVNAVDKHGNTPLPLAASVGHLEIVEVLLKAGADVNAQDQFGRTPLHLAAMWGHLEIVE
VLLKHGADVNAQDKFGKTAFDISIDNGNEDIVEVLQKAA

Primary citation

Designed Ankyrin Repeat Proteins as a tool box for analyzing p63. Strubel, A., Munick, P., Chaikuad, A. et al. Cell Death Differ (2022) 29:2445-2458. DOI 10.1038/s41418-022-01030-y · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1

Browse structure collections

About this viewer

MolViewer shows 7Z72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.