2YTU: PDB entry 2YTU

Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1 transcription factor. Determined by solution NMR. Released 8 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,033
Mol. weight: 14.76 kDa
Released: 8 Apr 2008

Explore 2YTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YTU contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	38-40	3
α-helix	45-56	12
α-helix	65-67	3
α-helix	74-77	4
α-helix	80-86	7
α-helix	89-109	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Friend leukemia integration 1 transcription factor	A	protein	128	Homo sapiens	Q01543 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YTU_1 Friend leukemia integration 1 transcription factor (chains A)
GSSGSSGMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYSLM
EIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQSS
RLSVKEDP

Primary citation

Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1 transcription factor. Goroncy, A.K., Sato, M., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt Q01543 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CP6 1.66 Å, Crystal structure of the DNA binding domain of FLI1 (residues 259-371)
9MX9 2.55 Å, Crystal structure of the DNA binding domain of FLI1 (F362A) in complex with a DNA…
9MXA 2.59 Å, Crystal structure of the DNA binding domain of FLI1 (wild-type) in complex with a DNA…
5E8G 2.7 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1
5JVT 3.1 Å, Crystal structure of the DNA binding domain of transcription factor FLI1 in complex with…
9MX8 3.15 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
9MWY 3.28 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
5E8I 3.45 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
6VG2 3.9 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
6VGD 4.2 Å, Crystal structure of the DNA binding domain (DBD) of human FLI1 and the complex of the…
6VG8 4.31 Å, Crystal structure of the DNA binding domains of human FLI1 and Runx2 in complex with…
1FLI DNA-binding domain of fli-1

Browse structure collections

About this viewer

MolViewer shows 2YTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.