2Z5N: Complex of Transportin 1 with hnRNP D NLS

Complex of Transportin 1 with hnRNP D NLS. Determined by X-ray diffraction at 3.2 Å resolution. Released 23 Oct 2007.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,817
Mol. weight: 104.18 kDa
Released: 23 Oct 2007

Explore 2Z5N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z5N contains 63 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 63 helices, 0 β-strands

Element	Residues	Length
α-helix	15-20	6
α-helix	27-38	12
α-helix	39-42	4
α-helix	46-55	10
α-helix	62-77	16
α-helix	85-97	13
α-helix	98-100	3
α-helix	104-120	17
α-helix	129-133	5
α-helix	142-158	17
α-helix	176-181	6
α-helix	182-184	3
α-helix	188-199	12
α-helix	207-210	4
α-helix	215-221	7
α-helix	229-241	13
α-helix	247-249	3
α-helix	254-264	11
α-helix	270-283	14
α-helix	287-291	5
α-helix	293-305	13
α-helix	310-311	2
α-helix	312-316	5
α-helix	375-390	16
α-helix	395-397	3
α-helix	399-406	8
α-helix	411-423	13
α-helix	430-435	6
α-helix	436-446	11
α-helix	452-463	12
α-helix	466-471	6
α-helix	478-489	12
α-helix	494-510	17
α-helix	516-518	3
α-helix	519-528	10
α-helix	529-531	3
α-helix	535-552	18
α-helix	553-556	4
α-helix	559-574	16
α-helix	583-596	14
α-helix	605-627	23
α-helix	634-637	4
α-helix	639-655	17
α-helix	656-658	3
α-helix	660-664	5
α-helix	669-675	7
α-helix	681-697	17
α-helix	699-701	3
α-helix	706-715	10
α-helix	722-739	18
α-helix	740-743	4
α-helix	747-758	12
α-helix	765-781	17
α-helix	783-786	4
α-helix	787-789	3
α-helix	796-801	6
α-helix	808-823	16
α-helix	825-827	3
α-helix	829-831	3
α-helix	832-840	9
α-helix	847-864	18
α-helix	866-873	8
α-helix	878-887	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1	A	protein	890	Homo sapiens	Q92973 (AlphaFold model)
Heterogeneous nuclear ribonucleoprotein D0	B	protein	24		Q14103 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Z5N_1 Transportin-1 (chains A)
MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE
DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK
GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL
QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV
MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL
IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDD
DDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILV
LGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKP
LMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLI
LYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSG
FLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIE
QLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPE
FISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGY
VCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVA
SWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>2Z5N_2 Heterogeneous nuclear ribonucleoprotein D0 (chains B)
YSNQQSGYGKVSRRGGHQNSYKPY

Primary citation

Structural basis for substrate recognition and dissociation by human transportin 1. Imasaki, T., Shimizu, T., Hashimoto, H. et al. Mol Cell (2007) 28:57-67. DOI 10.1016/j.molcel.2007.08.006 · PubMed

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
5YVI 2.9 Å, Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
4FQ3 3.0 Å, Crystal structure of transportin/FUS-NLS
5TQC 3.0 Å, Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of…
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…

Browse structure collections

About this viewer

MolViewer shows 2Z5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.