2Z5V: TIR domain of human MyD88

Solution structure of the TIR domain of human MyD88. Determined by solution NMR. Released 5 Aug 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,159
Mol. weight: 17.39 kDa
Released: 5 Aug 2008

Explore 2Z5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z5V contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-19	4	1
α-helix	25-36	12
β-strand	44-45	2	1
β-strand	71-75	5	1
α-helix	78-81	4
α-helix	84-94	11
β-strand	105-109	5	1
β-strand	127-128	2	1
α-helix	132-135	4
α-helix	138-146	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid differentiation primary response protein MyD88	A	protein	149	Homo sapiens	Q99836 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Z5V_1 Myeloid differentiation primary response protein MyD88 (chains A)
TTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI
ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSI
LRFITVCDYTNPCTKSWFWTRLAKALSLP

Primary citation

Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling. Ohnishi, H., Tochio, H., Kato, Z. et al. Proc Natl Acad Sci U S A (2009). DOI 10.1073/pnas.0812956106 · PubMed

Other PDB entries of the same protein (UniProt Q99836 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EO7 1.45 Å, Crystal structure of the TIR domain of human myeloid differentiation primary response…
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
4DOM 1.8 Å, Crystal Structure of the TIR-domain of Human Myeloid Differentiation Primary Response…
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain
7BER 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly (solved, rebuilt and refined…
7L6W 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly
8S78 2.85 Å, MicroED Structure of TLR2 TIR domain-induced MyD88 TIR domain higher-order assembly
7BEQ 3.0 Å, MicroED structure of the MyD88 TIR domain higher-order assembly
6I3N 3.1 Å, Helical MyD88 death domain filament
8W8M 3.28 Å, Cryo-EM structure of helical filament of MyD88 TIR
8YYM 3.3 Å, Cryo-EM structure of cylindrical fiber of MyD88 TIR
3MOP 3.4 Å, The ternary Death Domain complex of MyD88, IRAK4, and IRAK2

Browse structure collections

About this viewer

MolViewer shows 2Z5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.