2ZIV: Mus81-Eme1 complex

Crystal structure of the Mus81-Eme1 complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 29 Apr 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Danio rerio, Homo sapiens
Chains: 2
Atoms: 4,425
Mol. weight: 74.33 kDa
Released: 29 Apr 2008

Explore 2ZIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZIV contains 27 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	313-314	2	1
β-strand	319-325	7	2
α-helix	327-329	3
α-helix	340-343	4
β-strand	352-353	2	2
β-strand	362-368	7	2
β-strand	384-386	3	2
β-strand	389-395	7	2
α-helix	396-405	10
α-helix	408-416	9
β-strand	422-428	7	2
α-helix	434-437	4
α-helix	441-453	13
β-strand	458-461	4	2
α-helix	465-483	19
β-strand	488-490	3	1
β-strand	513-514	2	1
β-strand	515-516	2	2
α-helix	517-527	11
β-strand	530-531	2	3
α-helix	532-540	9
β-strand	543	1	4
α-helix	548-557	10
α-helix	561-570	10
α-helix	574-579	6
β-strand	585-586	2	5
β-strand	591-592	2	5
α-helix	595-606	12

Chain B: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	253-256	4	6
α-helix	258-261	4
α-helix	266-275	10
β-strand	279-282	4	6
β-strand	290-294	5	6
α-helix	306-307	2
β-strand	308	1	6
α-helix	309	1
β-strand	312-317	6	6
α-helix	318-324	7
α-helix	345-352	8
β-strand	359-364	6	6
α-helix	405-418	14
β-strand	422	1	6
β-strand	425-426	2	6
α-helix	429-443	15
α-helix	456-460	5
β-strand	469	1	4
α-helix	478-486	9
α-helix	494-503	10
α-helix	507-515	9
α-helix	520-523	4
β-strand	531	1	7
β-strand	544	1	7
α-helix	547-558	12
β-strand	565-566	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mus81 protein	A	protein	311	Danio rerio	Q7SXA9 (AlphaFold model)
Crossover junction endonuclease EME1	B	protein	351	Homo sapiens, Danio rerio	E7F6N8 (AlphaFold model), Q96AY2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZIV_1 Mus81 protein (chains A)
MSETGRTAMGWHLSPGSYDIVLCVDLCETTGGSSVRKQELVKELQRNSVTFDVRKLNVGD
FLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLR
KPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQK
LYQNCTLFCRSRELEGDGEAESEKMVANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLM
QISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTI
YQLYCTRGPLS

Sequence of entity 2 (B), FASTA

>2ZIV_2 Crossover junction endonuclease EME1 (chains B)
MGSSHHHHHHSQDPNSEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPC
SVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTD
ITAKTAGKALSLVIVDQEKYFRSQNSKCQKKYREAVLGEEKNVGLQGGQKKRRKKDDINQ
LPEVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSF
CLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFS
DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD

Primary citation

Crystal structure of the Mus81-Eme1 complex. Chang, J.H., Kim, J.J., Choi, J.M. et al. Genes Dev (2008) 22:1093-1106. DOI 10.1101/gad.1618708 · PubMed

Other PDB entries of the same protein (UniProt Q7SXA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZIU 2.7 Å, Crystal structure of the Mus81-Eme1 complex
2ZIW 2.8 Å, Crystal structure of the Mus81-Eme1 complex

Browse structure collections

About this viewer

MolViewer shows 2ZIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.