2ZJD: LC3-p62 complex

Crystal Structure of LC3-p62 complex. Determined by X-ray diffraction at 1.56 Å resolution. Released 3 Jun 2008.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,435
Mol. weight: 32.62 kDa
Released: 3 Jun 2008

Explore 2ZJD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZJD contains 16 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	38	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	79-83	5	1
β-strand	87-88	2	1
β-strand	94	1	2
α-helix	95-102	8
α-helix	108	1
β-strand	109-115	7	1
α-helix	116-121	6

Chains B and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	341-342	2	1

Chain C: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	3
α-helix	45-47	3
β-strand	51-55	5	3
β-strand	59	1	4
α-helix	60-71	12
β-strand	80-83	4	3
β-strand	86	1	3
β-strand	94	1	4
α-helix	95-102	8
α-helix	108	1
β-strand	109-114	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3B precursor	A, C	protein	130	Homo sapiens	Q9GZQ8 (AlphaFold model)
undecameric peptide from Sequestosome-1	B, D	protein	11		Q64337 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2ZJD_1 Microtubule-associated proteins 1A/1B light chain 3B precursor (chains A, C)
GPLGSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVP
DHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYAS
QETFGMKLSV

Sequence of entity 2 (B, D), FASTA

>2ZJD_2 undecameric peptide from Sequestosome-1 (chains B, D)
SGGDDDWTHLS

Primary citation

Structural Basis for Sorting Mechanism of p62 in Selective Autophagy. Ichimura, Y., Kumanomidou, T., Sou, Y.-S. et al. J Biol Chem (2008) 283:22847-22857. DOI 10.1074/jbc.M802182200 · PubMed

Other PDB entries of the same protein (UniProt Q9GZQ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q53 1.36 Å, Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain…
6LAN 1.41 Å, Structure of CCDC50 and LC3B complex
5D94 1.53 Å, Crystal structure of LC3-LIR peptide complex
5MS5 1.53 Å, Low-salt structure of RavZ LIR2-fused human LC3B
7GAG 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
7GAU 1.59 Å, PanDDA analysis group deposition of ground-state model of MAP1LC3B
7ELG 1.6 Å, LC3B modificated with a covalent probe
3VTU 1.6 Å, Crystal structure of human LC3B_2-119
8Q7K 1.6 Å, IRGQ LIR2 peptide in complex with LC3B
7GAP 1.68 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
7GAO 1.69 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119

Browse structure collections

About this viewer

MolViewer shows 2ZJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.