2ZNL: Polymerase acidic protein

Crystal structure of PA-PB1 complex form influenza virus RNA polymerase. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Sept 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Influenza A virus
Chains: 2
Atoms: 3,569
Mol. weight: 63.53 kDa
Released: 2 Sept 2008

Explore 2ZNL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZNL contains 18 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	268-272	5
β-strand	275	1	1
α-helix	276	1
β-strand	287	1	2
β-strand	290-293	4	2
α-helix	303-311	9
β-strand	317-324	8	2
α-helix	331-345	15
β-strand	359	1	3
α-helix	360-361	2
α-helix	364-369	6
β-strand	402	1	1
α-helix	406-414	9
β-strand	417	1	4
β-strand	421	1	2
α-helix	437-450	14
β-strand	453	1	4
α-helix	454-474	21
β-strand	481	1	3
β-strand	482-490	9	2
β-strand	496-506	11	2
β-strand	517-526	10	2
α-helix	530-532	3
β-strand	541-548	8	2
β-strand	559-571	13	2
α-helix	572-579	8
α-helix	583-602	20
α-helix	608-613	6
β-strand	619-624	6	5
β-strand	627-631	5	5
α-helix	633-649	17
α-helix	653-674	22
α-helix	686-691	6
α-helix	698-714	17

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	5
α-helix	5-10	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase acidic protein	A	protein	478	Influenza A virus	P03433 (AlphaFold model)
RNA-directed RNA polymerase catalytic subunit	B	protein	81	Influenza A virus	P03431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZNL_1 Polymerase acidic protein (chains A)
NGYIEGKLSQMSKEVNARIEPFLKTTPRPLRLPNGPPCSQRSKFLLMDALKLSIEDPSHE
GEGIPLYDAIKCMRTFFGWKEPNVVKPHEKGINPNYLLSWKQVLAELQDIENEEKIPKTK
NMKKTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPELRSLASWIQNEFNKACELT
DSSWIELDEIGEDVAPIEHIASMRRNYFTSEVSHCRATEYIMKGVYINTALLNASCAAMD
DFQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWE
KYCVLEIGDMLIRSAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEA
ESSVKEKDMTKEFFENKSETWPIGESPKGVEESSIGKVCRTLLAKSVFNSLYASPQLEGF
SAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALS

Sequence of entity 2 (B), FASTA

>2ZNL_2 RNA-directed RNA polymerase catalytic subunit (chains B)
MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGRWTTNTE
TGAPQLNPIDGPLPEDNEPSG

Primary citation

The structural basis for an essential subunit interaction in influenza virus RNA polymerase. Obayashi, E., Yoshida, H., Kawai, F. et al. Nature (2008) 454:1127-1131. DOI 10.1038/nature07225 · PubMed

Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XGC 1.6 Å, Crystal structure of influenza polymerase acidic subunit N-terminal domain crystallized…
5JHT 1.75 Å, Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region…
4ZQQ 1.8 Å, Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region
4ZI0 1.8 Å, Endonuclease inhibitor bound to influenza strain H1N1 polymerase acidic subunit…
4YYL 1.91 Å, Phenolic acid derivative bound to influenza strain H1N1 polymerase subunit PA endonuclease
5FDG 2.1 Å, Endonuclease inhibitor 3 bound to influenza strain H1N1 polymerase acidic subunit…
5I13 2.15 Å, Endonuclease inhibitor 2 bound to influenza strain H1N1 polymerase acidic subunit…
4ZHZ 2.5 Å, Endonuclease inhibitor bound to influenza strain H1N1 polymerase acidic subunit…
5FDD 2.51 Å, Endonuclease inhibitor 1 bound to influenza strain H1N1 polymerase acidic subunit…
5JHV 2.75 Å, Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region…

Browse structure collections

About this viewer

MolViewer shows 2ZNL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.