3A1J: Human Rad9-Hus1-Rad1 complex

Crystal structure of the human Rad9-Hus1-Rad1 complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 2 Jun 2009.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,467
Mol. weight: 92.26 kDa
Released: 2 Jun 2009

Explore 3A1J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A1J contains 33 α-helices and 56 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	8-21	14
β-strand	26-32	7	2
β-strand	35-41	7	2
β-strand	47-53	7	2
α-helix	55-57	3
β-strand	60-62	3	1
β-strand	73-76	4	2
α-helix	77-84	8
α-helix	87-93	7
β-strand	94-100	7	1
β-strand	107-114	8	1
α-helix	115-117	3
β-strand	119-125	7	1
β-strand	127-128	2	2
α-helix	130-132	3
α-helix	138-140	3
β-strand	143-148	6	2
α-helix	149-156	8
β-strand	165-170	6	3
α-helix	172-174	3
β-strand	176-181	6	3
α-helix	191-193	3
β-strand	194-199	6	3
α-helix	201-203	3
β-strand	206-208	3	2
β-strand	214-218	5	3
α-helix	219-231	13
β-strand	235-240	6	2
β-strand	247-252	6	2
β-strand	256-262	7	2

Chain B: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	3
α-helix	10-26	17
β-strand	29-34	6	4
β-strand	38-43	6	4
β-strand	53-59	7	4
α-helix	60-62	3
β-strand	66-70	5	3
β-strand	79-84	6	4
α-helix	85-91	7
α-helix	92-97	6
β-strand	98-106	9	3
β-strand	112-119	8	3
β-strand	128-134	7	3
β-strand	136-137	2	4
α-helix	138-139	2
α-helix	140-146	7
α-helix	148-150	3
α-helix	152-154	3
β-strand	156-159	4	4
α-helix	163-174	12
β-strand	179-184	6	5
β-strand	190-195	6	5
β-strand	199-205	7	5
α-helix	226-227	2
β-strand	228-233	6	5
α-helix	234-243	10
β-strand	250-256	7	4
β-strand	260-266	7	4
β-strand	271-277	7	4
α-helix	278-279	2

Chain C: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	5
α-helix	25-32	8
β-strand	39-45	7	6
β-strand	48-55	8	6
β-strand	59-66	8	6
α-helix	67-69	3
β-strand	72-75	4	5
β-strand	80-85	6	6
α-helix	86-93	8
α-helix	100-101	2
β-strand	107-112	6	5
β-strand	119-125	7	5
β-strand	128-134	7	5
β-strand	137	1	6
β-strand	152-159	8	6
α-helix	160-163	4
α-helix	164-168	5
β-strand	176-181	6	1
β-strand	188-194	7	1
β-strand	197-203	7	1
β-strand	210-215	6	6
β-strand	219-224	6	1
α-helix	225-228	4
α-helix	231-237	7
β-strand	240-246	7	6
β-strand	251-258	8	6
β-strand	264-271	8	6
α-helix	272-274	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell cycle checkpoint control protein RAD9A	A	protein	266	Homo sapiens	Q99638 (AlphaFold model)
Checkpoint protein HUS1	B	protein	281	Homo sapiens	O60921 (AlphaFold model)
Cell cycle checkpoint protein RAD1	C	protein	263	Homo sapiens	O60671 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3A1J_1 Cell cycle checkpoint control protein RAD9A (chains A)
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLS

Sequence of entity 2 (B), FASTA

>3A1J_2 Checkpoint protein HUS1 (chains B)
HMKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELE
QENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVEL
LSMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNH
LVIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQ
FLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS

Sequence of entity 3 (C), FASTA

>3A1J_3 Cell cycle checkpoint protein RAD1 (chains C)
DQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQE
FKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVC
KINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLST
FGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLS
LQYMIRNEDGQICFVEYYCCPDE

Primary citation

Crystal Structure of the Human Rad9-Hus1-Rad1 Clamp. Sohn, S.Y., Cho, Y. J Mol Biol (2009) 390:490-502. DOI 10.1016/j.jmb.2009.05.028 · PubMed

Other PDB entries of the same protein (UniProt Q99638 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JZY 1.5 Å, RPA70N-RAD9 fusion
8GNN 2.12 Å, Crystal structure of the human RAD9-RAD1-HUS1-RAD17 complex
6HM5 2.33 Å, Crystal structure of TOPBP1 BRCT0,1,2 in complex with a RAD9 phosphopeptide
6J8Y 2.4 Å, Crystal structure of the human RAD9-HUS1-RAD1-RHINO complex
8WU8 2.81 Å, Crystal structure of the human RAD9-RAD1(F64A/M256A/F266A)-HUS1-RHINO(88-99) complex
3G65 2.9 Å, Crystal Structure of the Human Rad9-Rad1-Hus1 DNA Damage Checkpoint Complex
3GGR 3.2 Å, Crystal Structure of the Human Rad9-Hus1-Rad1 complex
7Z6H 3.59 Å, Structure of DNA-bound human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp

Browse structure collections

About this viewer

MolViewer shows 3A1J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.