3GGR: Human Rad9-Hus1-Rad1 complex

Name: PDB 3GGR: Crystal Structure of the Human Rad9-Hus1-Rad1 complex
Published: 2009-06-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell cycle

Crystal Structure of the Human Rad9-Hus1-Rad1 complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 16 Jun 2009.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,325
Mol. weight: 94.16 kDa
Released: 16 Jun 2009

Explore 3GGR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GGR contains 18 α-helices and 70 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	9-20	12
β-strand	26-30	5	2
β-strand	36-39	4	2
β-strand	41	1	2
β-strand	47-53	7	2
α-helix	55-57	3
β-strand	60-61	2	1
β-strand	73-76	4	2
α-helix	77-84	8
β-strand	96-101	6	1
β-strand	108-113	6	1
β-strand	118-123	6	1
β-strand	143-148	6	2
α-helix	149-156	8
β-strand	168-170	3	3
β-strand	177-180	4	3
β-strand	195-199	5	3
β-strand	206-207	2	2
β-strand	214-216	3	3
α-helix	219-227	9
α-helix	233	1
β-strand	234-239	6	2
β-strand	247-252	6	2
β-strand	256-262	7	2

Chain B: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	3
α-helix	12-24	13
β-strand	31-34	4	4
β-strand	40-43	4	4
β-strand	54-58	5	4
β-strand	67-69	3	3
β-strand	79-83	5	4
α-helix	85-92	8
β-strand	100-105	6	3
β-strand	112	1	5
β-strand	113-119	7	3
β-strand	128-132	5	3
β-strand	135	1	5
β-strand	136-137	2	4
α-helix	138-140	3
α-helix	143-146	4
β-strand	156	1	6
β-strand	159	1	7
α-helix	165-176	12
β-strand	180-184	5	8
β-strand	190-195	6	8
β-strand	199-204	6	8
β-strand	229	1	8
β-strand	232-233	2	8
α-helix	236-241	6
β-strand	250	1	4
β-strand	252	1	7
β-strand	255-256	2	6
β-strand	260-261	2	6
β-strand	262-267	6	4
β-strand	270-275	6	4

Chain C: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17-20	4	8
α-helix	25-32	8
β-strand	39-45	7	9
β-strand	48-52	5	9
β-strand	53-54	2	10
β-strand	59	1	9
β-strand	60-61	2	10
β-strand	62-66	5	9
α-helix	67-69	3
β-strand	72-75	4	8
β-strand	80	1	9
β-strand	83-85	3	9
α-helix	86-90	5
β-strand	105-111	7	8
β-strand	116-124	9	8
β-strand	129-137	9	8
β-strand	155-157	3	11
α-helix	160-166	7
β-strand	174-179	6	12
β-strand	188	1	12
β-strand	189-194	6	1
β-strand	197-202	6	1
β-strand	213-214	2	11
β-strand	219-224	6	12
α-helix	225-230	6
α-helix	231-235	5
β-strand	239	1	13
β-strand	241-243	3	11
β-strand	244	1	9
β-strand	252-256	5	9
β-strand	257	1	13
β-strand	265-271	7	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell cycle checkpoint control protein RAD9A	A	protein	270	Homo sapiens	Q99638 (AlphaFold model)
Checkpoint protein HUS1	B	protein	286	Homo sapiens	O60921 (AlphaFold model)
Cell cycle checkpoint protein RAD1	C	protein	282	Homo sapiens	O60671 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GGR_1 Cell cycle checkpoint control protein RAD9A (chains A)
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDS

Sequence of entity 2 (B), FASTA

>3GGR_2 Checkpoint protein HUS1 (chains B)
MHHHHHHKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSM
WCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLT
VSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMK
NISNHLVIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDI
RKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS

Sequence of entity 3 (C), FASTA

>3GGR_3 Cell cycle checkpoint protein RAD1 (chains C)
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLM
LFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES

Primary citation

Structure and functional implications of the human rad9-hus1-rad1 cell cycle checkpoint complex. Xu, M., Bai, L., Gong, Y. et al. J Biol Chem (2009) 284:20457-20461. DOI 10.1074/jbc.C109.022384 · PubMed

Other PDB entries of the same protein (UniProt Q99638 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JZY 1.5 Å, RPA70N-RAD9 fusion
8GNN 2.12 Å, Crystal structure of the human RAD9-RAD1-HUS1-RAD17 complex
6HM5 2.33 Å, Crystal structure of TOPBP1 BRCT0,1,2 in complex with a RAD9 phosphopeptide
6J8Y 2.4 Å, Crystal structure of the human RAD9-HUS1-RAD1-RHINO complex
3A1J 2.5 Å, Crystal structure of the human Rad9-Hus1-Rad1 complex
8WU8 2.81 Å, Crystal structure of the human RAD9-RAD1(F64A/M256A/F266A)-HUS1-RHINO(88-99) complex
3G65 2.9 Å, Crystal Structure of the Human Rad9-Rad1-Hus1 DNA Damage Checkpoint Complex
7Z6H 3.59 Å, Structure of DNA-bound human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp

Browse structure collections

About this viewer

MolViewer shows 3GGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.