8WU8: Cell cycle checkpoint control protein RAD9A

Name: PDB 8WU8: Crystal structure of the human RAD9-RAD1(F64A/M256A/F266A)-HUS1-RHINO(88-99) complex
Published: 2024-02-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell cycle

Crystal structure of the human RAD9-RAD1(F64A/M256A/F266A)-HUS1-RHINO(88-99) complex. Determined by X-ray diffraction at 2.81 Å resolution. Released 14 Feb 2024.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,171
Mol. weight: 95.34 kDa
Released: 14 Feb 2024

Explore 8WU8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WU8 contains 25 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	9-21	13
β-strand	26-27	2	2
β-strand	28-32	5	3
β-strand	35-41	7	3
β-strand	47-53	7	3
α-helix	55-57	3
β-strand	60-62	3	1
β-strand	75-76	2	2
α-helix	77-84	8
α-helix	88-92	5
β-strand	96-100	5	1
β-strand	108-113	6	1
α-helix	115-117	3
β-strand	119-124	6	1
β-strand	134	1	4
α-helix	138-140	3
β-strand	143-148	6	3
α-helix	149-155	7
β-strand	165-171	7	5
β-strand	175-180	6	5
β-strand	194-199	6	5
β-strand	206-208	3	3
β-strand	214-218	5	5
α-helix	219-231	13
β-strand	235-240	6	3
β-strand	247-252	6	3
β-strand	256-262	7	3

Chain B: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	5
α-helix	10-26	17
β-strand	29-34	6	6
β-strand	38-43	6	6
β-strand	53-59	7	6
α-helix	60-62	3
β-strand	66-70	5	5
β-strand	79-84	6	6
α-helix	85-93	9
β-strand	100-107	8	5
β-strand	111-119	9	5
β-strand	127-134	8	5
β-strand	137	1	6
α-helix	140-143	4
α-helix	144-146	3
β-strand	156-159	4	6
α-helix	163-174	12
β-strand	179-185	7	7
β-strand	190-195	6	7
β-strand	199-205	7	7
β-strand	227-233	7	7
α-helix	234-241	8
β-strand	250-256	7	6
β-strand	260-266	7	6
β-strand	270-277	8	6

Chain C: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	7
α-helix	25-32	8
β-strand	39-45	7	8
β-strand	48-55	8	8
β-strand	59-65	7	8
β-strand	72-75	4	7
β-strand	80-85	6	8
α-helix	86-93	8
β-strand	107-112	6	7
α-helix	118	1
β-strand	119-125	7	7
β-strand	128-134	7	7
β-strand	137	1	8
α-helix	138-140	3
α-helix	142-145	4
β-strand	152-159	8	8
α-helix	160-168	9
β-strand	176-181	6	1
β-strand	187-194	8	1
β-strand	197-203	7	1
β-strand	210-215	6	8
β-strand	219-224	6	1
α-helix	225-228	4
α-helix	229-231	3
α-helix	232-235	4
β-strand	240-246	7	8
β-strand	251-258	8	8
β-strand	264-271	8	8

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	91-94	4
β-strand	96	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell cycle checkpoint control protein RAD9A	A	protein	270	Homo sapiens	Q99638 (AlphaFold model)
Checkpoint protein HUS1	B	protein	286	Homo sapiens	O60921 (AlphaFold model)
Cell cycle checkpoint protein RAD1	C	protein	282	Homo sapiens	O60671 (AlphaFold model)
RAD9, HUS1, RAD1-interacting nuclear orphan protein 1	D	protein	12	Homo sapiens	Q9BSD3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WU8_1 Cell cycle checkpoint control protein RAD9A (chains A)
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDS

Sequence of entity 2 (B), FASTA

>8WU8_2 Checkpoint protein HUS1 (chains B)
MHHHHHHKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSM
WCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLT
VSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMK
NISNHLVIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDI
RKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS

Sequence of entity 3 (C), FASTA

>8WU8_3 Cell cycle checkpoint protein RAD1 (chains C)
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAAIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLM
LFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYAIRNEDGQICAVEYYCCPDEEVPESES

Sequence of entity 4 (D), FASTA

>8WU8_4 RAD9, HUS1, RAD1-interacting nuclear orphan protein 1 (chains D)
TSKFPHLTFESP

Primary citation

Structural basis for intra- and intermolecular interactions on RAD9 subunit of 9-1-1 checkpoint clamp implies functional 9-1-1 regulation by RHINO. Hara, K., Tatsukawa, K., Nagata, K. et al. J Biol Chem (2024) 300:105751-105751. DOI 10.1016/j.jbc.2024.105751 · PubMed

Other PDB entries of the same protein (UniProt Q99638 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JZY 1.5 Å, RPA70N-RAD9 fusion
8GNN 2.12 Å, Crystal structure of the human RAD9-RAD1-HUS1-RAD17 complex
6HM5 2.33 Å, Crystal structure of TOPBP1 BRCT0,1,2 in complex with a RAD9 phosphopeptide
6J8Y 2.4 Å, Crystal structure of the human RAD9-HUS1-RAD1-RHINO complex
3A1J 2.5 Å, Crystal structure of the human Rad9-Hus1-Rad1 complex
3G65 2.9 Å, Crystal Structure of the Human Rad9-Rad1-Hus1 DNA Damage Checkpoint Complex
3GGR 3.2 Å, Crystal Structure of the Human Rad9-Hus1-Rad1 complex
7Z6H 3.59 Å, Structure of DNA-bound human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp

Browse structure collections

About this viewer

MolViewer shows 8WU8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.