Crystal Structure of a Dictyostelium P109A Mg2+-Actin in Complex with Human Gelsolin Segment 1. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Oct 2010.
Explore 3A5L in 3D Show helices and sheets RCSB PDB PDBe
3A5L contains 30 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 3 |
| β-strand | 16-21 | 6 | 3 |
| β-strand | 29-32 | 4 | 3 |
| β-strand | 35-38 | 4 | 4 |
| β-strand | 53-54 | 2 | 4 |
| α-helix | 56-60 | 5 | |
| α-helix | 62-64 | 3 | |
| β-strand | 65-68 | 4 | 4 |
| α-helix | 79-88 | 10 | |
| α-helix | 89-93 | 5 | |
| α-helix | 98-100 | 3 | |
| β-strand | 103-107 | 5 | 3 |
| α-helix | 113-121 | 9 | |
| α-helix | 122-126 | 5 | |
| β-strand | 131-136 | 6 | 3 |
| α-helix | 137-144 | 8 | |
| β-strand | 150-155 | 6 | 5 |
| β-strand | 160-166 | 7 | 5 |
| β-strand | 169-170 | 2 | 5 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 5 |
| α-helix | 182-196 | 15 | |
| α-helix | 205-216 | 12 | |
| α-helix | 223-232 | 10 | |
| β-strand | 238-241 | 4 | 6 |
| β-strand | 247-250 | 4 | 6 |
| α-helix | 253-262 | 10 | |
| α-helix | 264-267 | 4 | |
| α-helix | 274-282 | 9 | |
| α-helix | 290-294 | 5 | |
| β-strand | 297-300 | 4 | 5 |
| α-helix | 302-304 | 3 | |
| α-helix | 309-320 | 12 | |
| β-strand | 329-330 | 2 | 5 |
| α-helix | 335-337 | 3 | |
| α-helix | 338-348 | 11 | |
| α-helix | 350-352 | 3 | |
| β-strand | 357-358 | 2 | 3 |
| α-helix | 359-365 | 7 | |
| α-helix | 366-369 | 4 | |
| α-helix | 370-373 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-12 | 5 | |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 28-31 | 4 | 1 |
| α-helix | 32-33 | 2 | |
| α-helix | 34-36 | 3 | |
| β-strand | 39-41 | 3 | 2 |
| β-strand | 45-53 | 9 | 1 |
| β-strand | 59-67 | 9 | 1 |
| α-helix | 73-89 | 17 | |
| β-strand | 94-100 | 7 | 1 |
| α-helix | 106-110 | 5 | |
| β-strand | 117-119 | 3 | 2 |
| α-helix | 123-125 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gelsolin | S | protein | 127 | Homo sapiens | P06396 (AlphaFold model) |
| Major actin | C | protein | 375 | Dictyostelium discoideum | P07830 (AlphaFold model) |
>3A5L_1 Gelsolin (chains S) MGSVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQ YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKK GGVASGF
>3A5L_2 Major actin (chains C) DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDL AGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLS GGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKE EYDESGPSIVHRKCF
Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release. Murakami, K., Yasunaga, T., Noguchi, T.Q.P. et al. Cell (2010) 143:275-287. DOI 10.1016/j.cell.2010.09.034 · PubMed
Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3A5L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.