3A5O: Dictyostelium P109I Ca2+-Actin

Crystal Structure of a Dictyostelium P109I Ca2+-Actin in Complex with Human Gelsolin Segment 1. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Oct 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: HOMO SAPIENS, DICTYOSTELIUM DISCOIDEUM
Chains: 2
Atoms: 4,219
Mol. weight: 56.31 kDa
Ligands: ATP, CA
Released: 27 Oct 2010

Explore 3A5O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A5O contains 30 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 24 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	3
β-strand	16-21	6	3
β-strand	22	1	4
β-strand	24	1	4
β-strand	29-32	4	3
β-strand	35-38	4	5
β-strand	53-54	2	5
α-helix	56-60	5
α-helix	62-64	3
β-strand	65-68	4	5
β-strand	71-72	2	6
β-strand	75-76	2	6
α-helix	79-88	10
α-helix	89-94	6
α-helix	98-100	3
β-strand	103-107	5	3
α-helix	113-121	9
α-helix	122-126	5
β-strand	131-136	6	3
α-helix	137-144	8
β-strand	150-155	6	7
β-strand	160-166	7	7
β-strand	169-170	2	7
α-helix	172-174	3
β-strand	176-178	3	7
α-helix	182-196	15
α-helix	205-216	12
α-helix	223-232	10
β-strand	238-241	4	8
β-strand	247-250	4	8
α-helix	253-262	10
α-helix	264-267	4
α-helix	274-283	10
α-helix	290-294	5
β-strand	297-300	4	7
α-helix	302-304	3
α-helix	309-320	12
β-strand	329-330	2	7
α-helix	333-337	5
α-helix	338-348	11
α-helix	352-354	3
β-strand	357-358	2	3
α-helix	359-365	7
α-helix	366-369	4
α-helix	370-373	4

Chain S: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
β-strand	18-25	8	1
β-strand	28-31	4	1
α-helix	32-33	2
α-helix	34-36	3
β-strand	39-41	3	2
β-strand	45-53	9	1
β-strand	59-67	9	1
α-helix	73-89	17
β-strand	94-100	7	1
α-helix	106-109	4
β-strand	117-119	3	2
α-helix	124-125	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gelsolin	S	protein	127	HOMO SAPIENS	P06396 (AlphaFold model)
Major actin	C	protein	375	DICTYOSTELIUM DISCOIDEUM	P07830 (AlphaFold model)

Sequence of entity 1 (S), FASTA

>3A5O_1 Gelsolin (chains S)
MGSVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQ
YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKK
GGVASGF

Sequence of entity 2 (C), FASTA

>3A5O_2 Major actin (chains C)
DGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDL
AGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLS
GGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKE
EYDESGPSIVHRKCF

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
CA	Calcium ion	Ca	3

Primary citation

Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release. Murakami, K., Yasunaga, T., Noguchi, T.Q.P. et al. Cell (2010) 143:275-287. DOI 10.1016/j.cell.2010.09.034 · PubMed

Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FAF 1.05 Å, N184K pathological variant of gelsolin domain 2 (orthorhombic form)
6QW3 1.3 Å, Calcium-bound gelsolin domain 2
6LJE 1.4 Å, Crystal structure of gelsolin G3 domain (calcium and magnesium condition)
6LJF 1.5 Å, Crystal structure of gelsolin G3 domain (calcium condition)
2FH1 1.55 Å, C-terminal half of gelsolin soaked in low calcium at pH 4.5
3CIP 1.6 Å, Complex of Dictyostelium Discoideum Actin with Gelsolin
1KCQ 1.65 Å, Human Gelsolin Domain 2 with a Cd2+ bound
3CI5 1.7 Å, Complex of Phosphorylated Dictyostelium Discoideum Actin with Gelsolin
5FAE 1.7 Å, N184K pathological variant of gelsolin domain 2 (trigonal form)
5O2Z 1.7 Å, Domain swap dimer of the G167R variant of gelsolin second domain
1D4X 1.75 Å, Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin…
1NLV 1.8 Å, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human…

Browse structure collections

About this viewer

MolViewer shows 3A5O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.