3AA6: Actin capping protein

Crystal structure of Actin capping protein in complex with the Cp-binding motif derived from CD2AP. Determined by X-ray diffraction at 1.9 Å resolution. Released 4 Aug 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Gallus gallus, homo sapiens
Chains: 3
Atoms: 4,829
Mol. weight: 63.23 kDa
Ligands: BA
Released: 4 Aug 2010

Explore 3AA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AA6 contains 25 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-60	18
β-strand	64-66	3	1
β-strand	73-75	3	1
α-helix	78-80	3
β-strand	81	1	2
β-strand	86-89	4	2
β-strand	94-99	6	2
β-strand	104-110	7	2
α-helix	118-135	18
β-strand	140-148	9	3
β-strand	151-164	14	3
α-helix	165-167	3
β-strand	169-182	14	3
β-strand	185-198	14	3
β-strand	202-217	16	3
α-helix	221-249	29
α-helix	250-255	6
α-helix	256-258	3
α-helix	271-275	5

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5-13	9
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
β-strand	48-52	5	4
β-strand	57-61	5	4
α-helix	63-65	3
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-124	9	3
β-strand	127-137	11	3
α-helix	141-143	3
β-strand	145-158	14	3
β-strand	164-181	18	3
β-strand	185-202	18	3
α-helix	209-230	22
α-helix	231-236	6
α-helix	237-243	7

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	489-492	4
α-helix	499-502	4
α-helix	503-505	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1 and 2	B	protein	244	Gallus gallus	P14315 (AlphaFold model)
23mer peptide from CD2-associated protein	C	protein	23	homo sapiens	Q9Y5K6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AA6_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>3AA6_2 F-actin-capping protein subunit beta isoforms 1 and 2 (chains B)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLR

Sequence of entity 3 (C), FASTA

>3AA6_3 23mer peptide from CD2-associated protein (chains C)
NLLHLTANRPKMPGRRLPGRFNG

Ligands and cofactors

ID	Name	Formula	Copies
BA	Barium ion	Ba	1

Primary citation

Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition. Takeda, S., Minakata, S., Koike, R. et al. PLoS Biol (2010) 8:e1000416-e1000416. DOI 10.1371/journal.pbio.1000416 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ
3AAA 2.2 Å, Crystal Structure of Actin capping protein in complex with V-1

Browse structure collections

About this viewer

MolViewer shows 3AA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.