Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose 3'-sulfate. Determined by X-ray diffraction at 1.58 Å resolution. Released 26 Jan 2011.
Explore 3AP6 in 3D Show helices and sheets RCSB PDB PDBe
3AP6 contains 11 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 15-16 | 2 | |
| β-strand | 19-22 | 4 | 2 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 45-52 | 8 | 2 |
| α-helix | 60 | 1 | |
| β-strand | 61-69 | 9 | 2 |
| β-strand | 75-82 | 8 | 2 |
| β-strand | 85-86 | 2 | 2 |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 102-109 | 8 | 1 |
| β-strand | 113-118 | 6 | 1 |
| β-strand | 121-127 | 7 | 1 |
| α-helix | 132-134 | 3 | |
| β-strand | 137-142 | 6 | 2 |
| β-strand | 145-152 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-13 | 2 | 3 |
| α-helix | 15-16 | 2 | |
| β-strand | 19-22 | 4 | 4 |
| β-strand | 32-38 | 7 | 3 |
| β-strand | 45-51 | 7 | 4 |
| α-helix | 60-61 | 2 | |
| β-strand | 62-69 | 8 | 4 |
| β-strand | 75-82 | 8 | 4 |
| β-strand | 85-86 | 2 | 4 |
| β-strand | 90-92 | 3 | 4 |
| β-strand | 102-109 | 8 | 3 |
| β-strand | 113-118 | 6 | 3 |
| β-strand | 121-127 | 7 | 3 |
| α-helix | 132-134 | 3 | |
| β-strand | 137-142 | 6 | 4 |
| β-strand | 145-152 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 5 |
| β-strand | 19-22 | 4 | 6 |
| β-strand | 31-38 | 8 | 5 |
| β-strand | 45-52 | 8 | 6 |
| α-helix | 60 | 1 | |
| β-strand | 61-69 | 9 | 6 |
| β-strand | 75-82 | 8 | 6 |
| β-strand | 85-86 | 2 | 6 |
| β-strand | 90-92 | 3 | 6 |
| β-strand | 102-109 | 8 | 5 |
| β-strand | 113-118 | 6 | 5 |
| β-strand | 121-127 | 7 | 5 |
| α-helix | 132-134 | 3 | |
| β-strand | 137-142 | 6 | 6 |
| β-strand | 145-151 | 7 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin-8 | A, B, C, D | protein | 154 | Homo sapiens | O00214 (AlphaFold model) |
>3AP6_1 Galectin-8 (chains A, B, C, D) MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRA DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS
Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans. Ideo, H., Matsuzaka, T., Nonaka, T. et al. J Biol Chem (2011) 286:11346-11355. DOI 10.1074/jbc.M110.195925 · PubMed
Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.