Crystal structure of the N terminal domain of human Galectin 8. Determined by X-ray diffraction at 1.35 Å resolution. Released 19 Mar 2014.
Explore 4BMB in 3D Show helices and sheets RCSB PDB PDBe
4BMB contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 15-16 | 2 | |
| β-strand | 19-22 | 4 | 2 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 45-52 | 8 | 2 |
| α-helix | 60 | 1 | |
| β-strand | 61-69 | 9 | 2 |
| β-strand | 75-82 | 8 | 2 |
| β-strand | 85-86 | 2 | 2 |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 102-109 | 8 | 1 |
| β-strand | 113-118 | 6 | 1 |
| β-strand | 121-127 | 7 | 1 |
| α-helix | 132-134 | 3 | |
| β-strand | 137-142 | 6 | 2 |
| β-strand | 145-152 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin-8 | A | protein | 150 | HOMO SAPIENS | O00214 (AlphaFold model) |
>4BMB_1 GALECTIN-8 (chains A) SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVA FHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHT LLYGHRIGPEKIDTLGIYGKVNIHSIGFSF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (NA, GOL) are not listed.
Natural Single Amino Acid Polymorphism (F19Y) in Human Galectin-8: Detection of Structural Alterations and Increased Growth-Regulatory Activity on Tumor Cells. Ruiz, F.M., Scholz, B.A., Buzamet, E. et al. FEBS J (2014) 281:1446. DOI 10.1111/FEBS.12716 · PubMed
Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BMB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.