5GZC: Galectin-8 N-CRD with part of linker

Crystal structure of Galectin-8 N-CRD with part of linker. Determined by X-ray diffraction at 1.08 Å resolution. Released 21 Dec 2016.

Method: X-ray diffraction
Resolution: 1.08 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,473
Mol. weight: 17.32 kDa
Released: 21 Dec 2016

Explore 5GZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GZC contains 1 α-helix and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	16-20	5	1
β-strand	26-29	4	2
β-strand	39-45	7	1
β-strand	52-63	12	2
β-strand	66-76	11	2
β-strand	82-89	8	2
β-strand	92-93	2	2
β-strand	97-99	3	2
β-strand	109-116	8	1
β-strand	120-125	6	1
β-strand	128-134	7	1
α-helix	139-141	3
β-strand	144-149	6	2
β-strand	152-159	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin-8	A	protein	152	Homo sapiens	O00214 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GZC_1 Galectin-8 (chains A)
NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHF
NPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLY
GHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQ

Primary citation

Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker. Si, Y., Wang, Y., Gao, J. et al. Int J Mol Sci (2016) 17. DOI 10.3390/ijms17122088 · PubMed

Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYJ 1.08 Å, N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand
5GZD 1.19 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
9FXZ 1.3 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with…
5GZE 1.32 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
3AP9 1.33 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…
6Z6Y 1.34 Å, Galectin-8 N-terminal domain in complex with a sulfatide mimicking a sphingolipid
7ALS 1.35 Å, Alpha and beta Lactose isomer structure of Galectin 8, N-terminal domain
4BMB 1.35 Å, Crystal structure of the N terminal domain of human Galectin 8
31ML 1.5 Å, Crystal structure of the complex of galectin-8N-Methyl 2,6-anhydro-3-deoxy-3-S-(b-D-galac…
7P1M 1.52 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with benzimidazole…
3AP7 1.53 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…
3AP6 1.58 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…

Browse structure collections

About this viewer

MolViewer shows 5GZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.