3ASL: UHRF1

Structure of UHRF1 in complex with histone tail. Determined by X-ray diffraction at 1.41 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 1.41 Å
Organism: Homo sapiens
Chains: 2
Atoms: 696
Mol. weight: 9.68 kDa
Ligands: ZN
Released: 25 Jan 2012

Explore 3ASL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ASL contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	318	1	1
α-helix	327-329	3
β-strand	330-332	3	1
α-helix	333	1
β-strand	339-341	3	1
α-helix	342-344	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	70	Homo sapiens	Q96T88 (AlphaFold model)
Histone H3.3	B	protein	11	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ASL_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDE
WYCPECRNDA

Sequence of entity 2 (B), FASTA

>3ASL_2 Histone H3.3 (chains B)
ARTKQTARKST

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (EDO) are not listed.

Primary citation

Recognition of modification status on a histone H3 tail by linked histone reader modules of the epigenetic regulator UHRF1. Arita, K., Isogai, S., Oda, T. et al. Proc Natl Acad Sci U S A (2012) 109:12950-12955. DOI 10.1073/pnas.1203701109 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1
3SHB 1.8 Å, Crystal Structure of PHD Domain of UHRF1

Browse structure collections

About this viewer

MolViewer shows 3ASL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.