3BI7: SRA domain of E3 ubiquitin-protein ligase UHRF1

Name: PDB 3BI7: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
Published: 2007-12-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1. Determined by X-ray diffraction at 1.7 Å resolution. Released 18 Dec 2007.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,785
Mol. weight: 24.25 kDa
Released: 18 Dec 2007

Explore 3BI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BI7 contains 9 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	420-421	2
β-strand	429-430	2	1
α-helix	433-439	7
β-strand	449-452	4	1
β-strand	456-462	7	1
β-strand	471	1	1
β-strand	475-479	5	1
α-helix	503-511	9
β-strand	522-523	2	1
α-helix	527-529	3
α-helix	531-532	2
β-strand	533-538	6	1
α-helix	539-544	6
β-strand	553-568	16	1
β-strand	574-582	9	1
α-helix	587-588	2
α-helix	592-601	10
β-strand	606	1	1
α-helix	611-617	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	212	Homo sapiens	Q96T88 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BI7_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
MPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDH
GNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKP
VRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTK
EGKDRIKKLGLTMQYPEGYLEALANAHHHHHH

Primary citation

Structural basis for recognition of hemi-methylated DNA by the SRA domain of human UHRF1. Avvakumov, G.V., Walker, J.R., Xue, S. et al. Nature (2008) 455:822-826. DOI 10.1038/nature07273 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1
3SHB 1.8 Å, Crystal Structure of PHD Domain of UHRF1

Browse structure collections

About this viewer

MolViewer shows 3BI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.