3CDZ: Human factor VIII

Crystal structure of human factor VIII. Determined by X-ray diffraction at 3.98 Å resolution. Released 1 Apr 2008.

Method: X-ray diffraction
Resolution: 3.98 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,317
Mol. weight: 167.25 kDa
Ligands: CU, CA, NAG
Released: 1 Apr 2008

Explore 3CDZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CDZ contains 20 α-helices and 98 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9	1	2
β-strand	73-79	7	3
β-strand	83-84	2	4
β-strand	85-86	2	1
β-strand	87-88	2	5
β-strand	90	1	2
β-strand	99	1	6
β-strand	104	1	4
β-strand	112	1	7
α-helix	120-123	4
β-strand	134-135	2	5
β-strand	138-139	2	4
α-helix	142-144	3
α-helix	146-147	2
β-strand	153-154	2	3
β-strand	157-158	2	3
β-strand	159	1	6
β-strand	161	1	7
α-helix	164-171	8
β-strand	174-179	6	3
β-strand	194-197	4	8
α-helix	234-236	3
β-strand	253-257	5	8
β-strand	295-298	4	8
α-helix	313-316	4
β-strand	381-390	10	9
β-strand	393-394	2	10
β-strand	422-423	2	10
β-strand	426-431	6	9
β-strand	439	1	9
α-helix	440-442	3
α-helix	449-451	3
β-strand	453-456	4	11
β-strand	460-468	9	9
β-strand	476-478	3	11
β-strand	482-485	4	9
β-strand	508-514	7	9
α-helix	517-519	3
β-strand	528-534	7	11
α-helix	540-543	4
β-strand	548-554	7	11
β-strand	572-580	9	12
α-helix	581-583	3
α-helix	589-593	5
α-helix	606-610	5
β-strand	613-617	5	12
β-strand	620	1	12
β-strand	628	1	13
β-strand	634-642	9	12
β-strand	649-651	3	14
β-strand	658	1	15
β-strand	665	1	15
β-strand	668-670	3	14
β-strand	675-681	7	12
β-strand	688	1	16
β-strand	692	1	14
β-strand	701	1	12
β-strand	706	1	16
β-strand	707	1	13

Chain B: 7 helices, 51 β-strands

Element	Residues	Length	Sheet
β-strand	1695-1704	10	17
β-strand	1733-1737	5	17
α-helix	1760-1762	3
β-strand	1763-1765	3	18
β-strand	1769-1777	9	17
β-strand	1783	1	19
β-strand	1787	1	18
β-strand	1807	1	19
β-strand	1812-1819	8	17
β-strand	1832-1838	7	18
α-helix	1845-1848	4
β-strand	1852-1858	7	18
β-strand	1875-1878	4	20
α-helix	1891-1894	4
β-strand	1933-1935	3	21
α-helix	1939	1
β-strand	1940-1945	6	20
β-strand	1946	1	22
β-strand	1954-1958	5	21
β-strand	1963-1966	4	20
β-strand	1970-1973	4	20
β-strand	1975-1978	4	21
β-strand	1980	1	22
β-strand	1983-1988	6	20
β-strand	1994-2000	7	21
α-helix	2003-2006	4
β-strand	2012-2017	6	21
β-strand	2023-2024	2	23
β-strand	2052	1	23
β-strand	2062-2064	3	24
β-strand	2071-2087	17	23
β-strand	2089-2090	2	25
β-strand	2095-2096	2	25
β-strand	2098-2106	9	23
β-strand	2113	1	23
β-strand	2125-2127	3	23
β-strand	2138-2156	19	23
β-strand	2160-2162	3	24
β-strand	2163-2169	7	23
β-strand	2177	1	26
α-helix	2187-2189	3
β-strand	2190-2192	3	26
β-strand	2197	1	27
β-strand	2202	1	27
α-helix	2205-2207	3
β-strand	2219	1	28
β-strand	2230-2246	17	26
β-strand	2248-2249	2	29
β-strand	2254-2255	2	29
β-strand	2257-2265	9	26
β-strand	2272-2273	2	26
β-strand	2275	1	30
β-strand	2280	1	30
β-strand	2283-2284	2	26
β-strand	2293	1	26
β-strand	2296-2313	18	26
β-strand	2319	1	28
β-strand	2320-2326	7	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII heavy chain	A	protein	754	Homo sapiens	P00451 (AlphaFold model)
Coagulation factor VIII light chain	B	protein	684	Homo sapiens	P00451 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CDZ_1 Coagulation factor VIII heavy chain (chains A)
ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFTDHLFN
IAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQ
REKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCR
EGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNR
SLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLL
MDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRF
DDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIG
RKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGI
TDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNME
RDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAG
VQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKH
KMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYE
DSYEDISAYLLSKNNAIEPRSFSQNPPVLKRHQR

Sequence of entity 2 (B), FASTA

>3CDZ_2 Coagulation factor VIII light chain (chains B)
EITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWD
YGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVE
DNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKD
EFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFLTIFDETKS
WYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMG
SNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHA
GMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPF
SWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFG
NVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDA
QITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGV
KSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRI
HPQSWVHQIALRMEVLGCEAQDLY

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	2
CA	Calcium ion	Ca	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of human factor VIII: implications for the formation of the factor IXa-factor VIIIa complex. Ngo, J.C., Huang, M., Roth, D.A. et al. Structure (2008) 16:597-606. DOI 10.1016/j.str.2008.03.001 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…

Browse structure collections

About this viewer

MolViewer shows 3CDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.