3CW4: Polymerase basic protein 2

Large c-terminal domain of influenza a virus RNA-dependent polymerase PB2. Determined by X-ray diffraction at 2.7 Å resolution. Released 13 Jan 2009.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Influenza A virus
Chains: 1
Atoms: 1,728
Mol. weight: 25.3 kDa
Released: 13 Jan 2009

Explore 3CW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CW4 contains 11 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
α-helix	7-21	15
α-helix	23-32	10
α-helix	34-38	5
α-helix	41-43	3
α-helix	44-48	5
α-helix	55-71	17
α-helix	78-84	7
α-helix	85-88	4
β-strand	101-104	4	1
β-strand	111-114	4	1
β-strand	119	1	2
β-strand	122	1	2
β-strand	123-124	2	3
β-strand	130-132	3	3
β-strand	137-140	4	3
β-strand	153	1	4
β-strand	160-165	6	4
α-helix	168-170	3
β-strand	174	1	4
α-helix	176-180	5
β-strand	187-193	7	4
β-strand	196-202	7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase basic protein 2	A	protein	225	Influenza A virus	P03428 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CW4_1 Polymerase basic protein 2 (chains A)
MMWEINGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSG
FVRTLFQQMRDVLGTFDTAQIIKLLPFAAAPPKQSRMQFSSFTVNVRGSGMRILVRGNSP
VFNYNKATKRLTVLGKDAGTLTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELS
NLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN

Primary citation

Structural basis of the influenza A virus RNA polymerase PB2 RNA-binding domain containing the pathogenicity-determinant lysine 627 residue. Kuzuhara, T., Kise, D., Yoshida, H. et al. J Biol Chem (2009) 284:6855-6860. DOI 10.1074/jbc.C800224200 · PubMed

Other PDB entries of the same protein (UniProt P03428 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U6O 1.3 Å, Structure of the cap-binding domain of influenza virus polymerase subunit PB2
4ENF 1.32 Å, Crystal structure of the cap-binding domain of polymerase basic protein 2 from influenza…
3A1G 1.7 Å, High-Resolution Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A…
3WI1 1.93 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)…
3WI0 2.0 Å, P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1)
2ZTT 2.1 Å, Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus
4J2R 2.42 Å, Middle domain of influenza A virus RNA-dependent polymerase PB2
7JYW 2.9 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNW, an 9-mer influenza epitope
7JYX 2.95 Å, Crystal Structure of HLA A*2402 in complex with TYQWIIRNWET, an 11-mer epitope from…

Browse structure collections

About this viewer

MolViewer shows 3CW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.