3D94: Insulin-like growth factor-1 receptor kinase

Crystal structure of the insulin-like growth factor-1 receptor kinase in complex with PQIP. Determined by X-ray diffraction at 2.3 Å resolution. Released 29 Jul 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,519
Mol. weight: 34.98 kDa
Ligands: D94, CA
Released: 29 Jul 2008

Explore 3D94 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D94 contains 20 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	963	1	1
α-helix	966-968	3
β-strand	969-977	9	1
β-strand	982-989	8	1
β-strand	997-1005	9	1
α-helix	1011-1021	11
α-helix	1022-1026	5
β-strand	1032	1	2
α-helix	1033-1034	2
β-strand	1035-1039	5	1
β-strand	1045-1050	6	1
β-strand	1056	1	2
α-helix	1057-1062	6
α-helix	1079-1098	20
α-helix	1108-1110	3
β-strand	1111-1113	3	2
β-strand	1119-1121	3	2
α-helix	1125-1127	3
α-helix	1146-1148	3
α-helix	1151-1156	6
α-helix	1161-1176	16
α-helix	1180-1181	2
α-helix	1188-1196	9
α-helix	1201-1204	4
α-helix	1209-1218	10
α-helix	1223-1225	3
α-helix	1227-1228	2
α-helix	1229-1234	6
α-helix	1237-1239	3
α-helix	1244-1247	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor 1 receptor beta chain	A	protein	301	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3D94_1 Insulin-like growth factor 1 receptor beta chain (chains A)
VYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERI
EFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLA
PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDY
YRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV
MEGGLLDKPDNCPDMLLELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN
K

Ligands and cofactors

ID	Name	Formula	Copies
D94	3-[cis-3-(4-methylpiperazin-1-yl)cyclobutyl]-1-(2-phenylquinolin-7-yl)imidazo[1…	C30 H31 N7	1
CA	Calcium ion	Ca	1

Primary citation

Small-molecule inhibition and activation-loop trans-phosphorylation of the IGF1 receptor. Wu, J., Li, W., Craddock, B.P. et al. EMBO J (2008) 27:1985-1994. DOI 10.1038/emboj.2008.116 · PubMed

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 3D94 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.