3E7C: Glucocorticoid Receptor LBD

Glucocorticoid Receptor LBD bound to GSK866. Determined by X-ray diffraction at 2.15 Å resolution. Released 25 Nov 2008.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,330
Mol. weight: 63.78 kDa
Ligands: 866
Released: 25 Nov 2008

Explore 3E7C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3E7C contains 27 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-538	7
α-helix	540-543	4
α-helix	553-554	2
α-helix	556-578	23
α-helix	584-586	3
α-helix	589-613	25
β-strand	621-624	4	1
β-strand	627-629	3	1
α-helix	631-634	4
α-helix	640-655	16
α-helix	660-671	12
β-strand	674-676	3	2
α-helix	683-703	21
α-helix	708-710	3
α-helix	711-741	31
α-helix	751-766	16
β-strand	769-771	3	2

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-538	7
α-helix	540-545	6
α-helix	556-580	25
α-helix	584-586	3
α-helix	589-613	25
β-strand	621-624	4	3
β-strand	627-629	3	3
α-helix	631-634	4
α-helix	640-655	16
α-helix	660-671	12
β-strand	674-676	3	4
α-helix	683-702	20
α-helix	711-741	31
α-helix	751-758	8
α-helix	761-766	6
β-strand	769-771	3	4

Chains D and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-749	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucocorticoid receptor	A, B	protein	257	Homo sapiens	P04150 (AlphaFold model)
Nuclear receptor coactivator 2	D, H	protein	11	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3E7C_1 Glucocorticoid receptor (chains A, B)
VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKA
IPGFRNLHLDDQMTLLQYSWMYLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPGMY
DQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQ
IPKYSNGNIKKLLFHQK

Sequence of entity 2 (D, H), FASTA

>3E7C_2 Nuclear receptor coactivator 2 (chains D, H)
ENALLRYLLDK

Ligands and cofactors

ID	Name	Formula	Copies
866	5-amino-N-[(2S)-2-({[(2,6-dichlorophenyl)carbonyl](ethyl)amino}methyl)-3,3,3-tr…	C23 H21 Cl2 F4 N5 O3	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

The first X-ray crystal structure of the glucocorticoid receptor bound to a non-steroidal agonist. Madauss, K.P., Bledsoe, R.K., Mclay, I. et al. Bioorg Med Chem Lett (2008) 18:6097-6099. DOI 10.1016/j.bmcl.2008.10.021 · PubMed

Other PDB entries of the same protein (UniProt P04150 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDD 1.8 Å, GR in complex with desisobutyrylciclesonide
5E69 1.85 Å, Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex
4HN5 1.9 Å, GR DNA Binding Domain - TSLP nGRE Complex
4P6W 1.95 Å, Crystal Structure of mometasone furoate-bound glucocorticoid receptor ligand binding…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
5CBY 2.0 Å, AncGR2 DNA Binding Domain - (+)GRE Complex
5CBX 2.0 Å, AncGR DNA Binding Domain - (+)GRE Complex
6X6E 2.0 Å, Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a…
5UC3 2.01 Å, Structure of the dominant negative mutant Glucocorticoid Receptor alpha (L733K/N734P)…
6YMO 2.02 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pS617 peptide
6YO8 2.09 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide
3K22 2.1 Å, Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide

Browse structure collections

About this viewer

MolViewer shows 3E7C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.