3EAB: Spastin MIT
Crystal structure of Spastin MIT in complex with ESCRT III. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 Nov 2008.
- Method
- X-ray diffraction
- Resolution
- 2.5 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 5,977
- Mol. weight
- 94.42 kDa
- Released
- 11 Nov 2008
Explore 3EAB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3EAB contains 34 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 111-136 | 26 | |
| α-helix | 142-144 | 3 | |
| α-helix | 146-161 | 16 | |
| α-helix | 169-195 | 27 | |
Chain B: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 110-136 | 27 | |
| α-helix | 143-161 | 19 | |
| α-helix | 169-192 | 24 | |
Chain C: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 109-136 | 28 | |
| α-helix | 143-160 | 18 | |
| α-helix | 169-195 | 27 | |
Chain D: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 110-136 | 27 | |
| α-helix | 142-144 | 3 | |
| α-helix | 146-161 | 16 | |
| α-helix | 169-194 | 26 | |
Chain E: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 113-136 | 24 | |
| α-helix | 142-145 | 4 | |
| α-helix | 146-161 | 16 | |
| α-helix | 169-195 | 27 | |
Chain F: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 110-136 | 27 | |
| α-helix | 143-161 | 19 | |
| α-helix | 169-191 | 23 | |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 151-159 | 9 | |
| α-helix | 174-193 | 20 | |
Chain H: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 151-159 | 9 | |
| α-helix | 174-195 | 22 | |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Spastin | A, B, C, D, E, F | protein | 89 | Homo sapiens | Q9UBP0 (AlphaFold model) |
| CHMP1b | G, H, I, J, K, L | protein | 50 | Homo sapiens | Q7LBR1 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>3EAB_1 Spastin (chains A, B, C, D, E, F)
MGSMEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQ
GEQCERARRLQAKMMTNLVMAKDRLQLLE
Sequence of entity 2 (G, H, I, J, K, L), FASTA
>3EAB_2 CHMP1b (chains G, H, I, J, K, L)
QVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRD
Primary citation
Structural basis for midbody targeting of spastin by the ESCRT-III protein CHMP1B. Yang, D., Rismanchi, N., Renvoise, B. et al. Nat Struct Mol Biol (2008) 15:1278-1286. DOI 10.1038/nsmb.1512 · PubMed
Other PDB entries of the same protein (UniProt Q9UBP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7S7J 1.15 Å, Structure of Human SPASTIN-IST1 complex.
- 5Z6Q 3.0 Å, Crystal structure of AAA of Spastin
- 5Z6R 3.0 Å, Spastin aaa with ATP
- 3VFD 3.3 Å, Human spastin AAA domain
- 6PEK 4.2 Å, Structure of Spastin Hexamer (Subunit A-E) in complex with substrate peptide
- 6PEN 4.2 Å, Structure of Spastin Hexamer (whole model) in complex with substrate peptide
Browse structure collections
About this viewer
MolViewer shows 3EAB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.