7S7J: Human SPASTIN-IST1 complex

Structure of Human SPASTIN-IST1 complex. Determined by X-ray diffraction at 1.15 Å resolution. Released 28 Sept 2022.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 2
Atoms: 998
Mol. weight: 12.94 kDa
Ligands: CA
Released: 28 Sept 2022

Explore 7S7J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S7J contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	113-135	23
α-helix	142-161	20
α-helix	169-192	24

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	352-364	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spastin	A	protein	84	Homo sapiens	Q9UBP0 (AlphaFold model)
IST1 homolog	B	protein	23	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7S7J_1 Spastin (chains A)
EAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQC
ERARRLQAKMMTNLVMAKDRLQLL

Sequence of entity 2 (B), FASTA

>7S7J_2 IST1 homolog (chains B)
TSASEDIDFDDLSRRFEELKKKT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (PGE, CL, PG4) are not listed.

Primary citation

Comprehensive analysis of the human ESCRT-III-MIT domain interactome reveals new cofactors for cytokinetic abscission. Wenzel, D.M., Mackay, D.R., Skalicky, J.J. et al. Elife (2022) 11. DOI 10.7554/eLife.77779 · PubMed

Other PDB entries of the same protein (UniProt Q9UBP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EAB 2.5 Å, Crystal structure of Spastin MIT in complex with ESCRT III
5Z6Q 3.0 Å, Crystal structure of AAA of Spastin
5Z6R 3.0 Å, Spastin aaa with ATP
3VFD 3.3 Å, Human spastin AAA domain
6PEK 4.2 Å, Structure of Spastin Hexamer (Subunit A-E) in complex with substrate peptide
6PEN 4.2 Å, Structure of Spastin Hexamer (whole model) in complex with substrate peptide

Browse structure collections

About this viewer

MolViewer shows 7S7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.